Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate AO353_01525 AO353_01525 amino acid transporter
Query= uniprot:P70970 (276 letters) >FitnessBrowser__pseudo3_N2E3:AO353_01525 Length = 254 Score = 138 bits (347), Expect = 1e-37 Identities = 84/221 (38%), Positives = 130/221 (58%), Gaps = 13/221 (5%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNK---- 65 L ++ K G +++IG +GSGKST L+ +N L P G +SL I+ K + Sbjct: 19 LKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLETPNDGAMSLDGKQIRMVKDHHGMHV 78 Query: 66 ----DLKKLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMN-FGVKKEDAEQKAREMLQLV 119 +L++LR ++ +VFQ L+ TVL++I+ P GV K+DAE +AR L V Sbjct: 79 ADDAELQRLRTRLAMVFQ--HFNLWGHMTVLENITMAPRRVLGVSKKDAEDRARRYLDKV 136 Query: 120 GLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELH 179 GL + D+ P LSGGQ +RVAIA LAM+PEV++ DEPT+ LDP E++ + L Sbjct: 137 GLPARVADQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSALDPELVGEVLKVIQGLA 196 Query: 180 QRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDL 220 + G T I+VTH M A +++++ +H+G ++ G+P D+ Sbjct: 197 EEGR-TMIMVTHEMSFARKVSNQVLFLHQGRVEEEGAPEDV 236 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 254 Length adjustment: 25 Effective length of query: 251 Effective length of database: 229 Effective search space: 57479 Effective search space used: 57479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory