GapMind for catabolism of small carbon sources

 

Aligments for a candidate for kyn in Pseudomonas fluorescens FW300-N2E3

Align Kynureninase (EC 3.7.1.3) (characterized)
to candidate AO353_05935 AO353_05935 kynureninase

Query= reanno::pseudo3_N2E3:AO353_05935
         (416 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935 AO353_05935
           kynureninase
          Length = 416

 Score =  836 bits (2160), Expect = 0.0
 Identities = 416/416 (100%), Positives = 416/416 (100%)

Query: 1   MITRNDCLALDAQDPLAHLRHQFALPEGVIYLDGNSLGARPVAALERAQAVIAEEWGNGL 60
           MITRNDCLALDAQDPLAHLRHQFALPEGVIYLDGNSLGARPVAALERAQAVIAEEWGNGL
Sbjct: 1   MITRNDCLALDAQDPLAHLRHQFALPEGVIYLDGNSLGARPVAALERAQAVIAEEWGNGL 60

Query: 61  IRSWNSAGWRDLPERLGNRLAGLIGAGEGEVVVTDTTSINLFKVLGAALRVQAMRAPTRR 120
           IRSWNSAGWRDLPERLGNRLAGLIGAGEGEVVVTDTTSINLFKVLGAALRVQAMRAPTRR
Sbjct: 61  IRSWNSAGWRDLPERLGNRLAGLIGAGEGEVVVTDTTSINLFKVLGAALRVQAMRAPTRR 120

Query: 121 VIVSESSNFPTDLYIAEGLMDLLQQGYSLRLVDSPEELAQAIDQDTAVVMLTHVNYKTGY 180
           VIVSESSNFPTDLYIAEGLMDLLQQGYSLRLVDSPEELAQAIDQDTAVVMLTHVNYKTGY
Sbjct: 121 VIVSESSNFPTDLYIAEGLMDLLQQGYSLRLVDSPEELAQAIDQDTAVVMLTHVNYKTGY 180

Query: 181 MHDMQAVTALIHECGALAIWDLAHSAGAVPVDLRQAGADYAIGCTYKYLNGGPGSQAFVW 240
           MHDMQAVTALIHECGALAIWDLAHSAGAVPVDLRQAGADYAIGCTYKYLNGGPGSQAFVW
Sbjct: 181 MHDMQAVTALIHECGALAIWDLAHSAGAVPVDLRQAGADYAIGCTYKYLNGGPGSQAFVW 240

Query: 241 VAPQLCDLVTQPLSGWFGHSRQFDMASGYEPSSGIARYLCGTQPITSLAMVECGLEIFAQ 300
           VAPQLCDLVTQPLSGWFGHSRQFDMASGYEPSSGIARYLCGTQPITSLAMVECGLEIFAQ
Sbjct: 241 VAPQLCDLVTQPLSGWFGHSRQFDMASGYEPSSGIARYLCGTQPITSLAMVECGLEIFAQ 300

Query: 301 TDMPSLRRKSLALTDLFIQLVEQRCAAHDLKLITPREHARRGSHVSFEHPQGYAVIQALI 360
           TDMPSLRRKSLALTDLFIQLVEQRCAAHDLKLITPREHARRGSHVSFEHPQGYAVIQALI
Sbjct: 301 TDMPSLRRKSLALTDLFIQLVEQRCAAHDLKLITPREHARRGSHVSFEHPQGYAVIQALI 360

Query: 361 AQGVIGDYREPRIMRFGFTPLYTSFTEVFDAVQILGEILDQQTWSQAQFQVRHSVT 416
           AQGVIGDYREPRIMRFGFTPLYTSFTEVFDAVQILGEILDQQTWSQAQFQVRHSVT
Sbjct: 361 AQGVIGDYREPRIMRFGFTPLYTSFTEVFDAVQILGEILDQQTWSQAQFQVRHSVT 416


Lambda     K      H
   0.322    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 788
Number of extensions: 27
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 416
Length of database: 416
Length adjustment: 31
Effective length of query: 385
Effective length of database: 385
Effective search space:   148225
Effective search space used:   148225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

Align candidate AO353_05935 AO353_05935 (kynureninase)
to HMM TIGR01814 (kynU: kynureninase (EC 3.7.1.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01814.hmm
# target sequence database:        /tmp/gapView.5020.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01814  [M=400]
Accession:   TIGR01814
Description: kynureninase: kynureninase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   2.1e-108  348.7   0.0   2.6e-108  348.4   0.0    1.1  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935  AO353_05935 kynureninase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935  AO353_05935 kynureninase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.4   0.0  2.6e-108  2.6e-108       2     400 .]       8     400 ..       7     400 .. 0.91

  Alignments for each domain:
  == domain 1  score: 348.4 bits;  conditional E-value: 2.6e-108
                                     TIGR01814   2 ealdaadelkalRdeFalpkakdeneviyld.NSLalmp.kaakealkeeldkWakllveshevg 64 
                                                    alda+d+l++lR +Falp     + viyld NSL++ p +a+++a+  ++++W++ l++s++  
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935   8 LALDAQDPLAHLRHQFALP-----EGVIYLDgNSLGARPvAALERAQAVIAEEWGNGLIRSWN-- 65 
                                                   78*****************.....99****66***9988356788999999************.. PP

                                     TIGR01814  65 kapWleldealeklla..lvakekevvvmnsltvNlhkllasfykp....tekRakIlleakaFP 123
                                                   +a W +l+e+l + la  ++a e evvv++++++Nl+k+l +++++    +++R++I++e+++FP
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935  66 SAGWRDLPERLGNRLAglIGAGEGEVVVTDTTSINLFKVLGAALRVqamrAPTRRVIVSESSNFP 130
                                                   999********999888999************************9888889************** PP

                                     TIGR01814 124 sDlyaiesqlklkleveeslvqvepreeetlrledildviekeqdeiAlvllsgvqYkt.qlfdl 187
                                                   +Dly++e  + l  ++  sl+ v++ e          ++ ++ +++ A+v+l++v+Ykt  + d+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935 131 TDLYIAEGLMDLL-QQGYSLRLVDSPE----------ELAQAIDQDTAVVMLTHVNYKTgYMHDM 184
                                                   *******999998.5555565555555..........3334456679************999*** PP

                                     TIGR01814 188 aaitkaarkkgalvvfDLaHava.vpleLhdwdvDfAvwCsYKylnaspaagafvhekkakeelp 251
                                                   +a+t++ ++ gal+++DLaH+++ vp++L ++++D+A+ C+YKyln +p + afv+ ++   +l+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935 185 QAVTALIHECGALAIWDLAHSAGaVPVDLRQAGADYAIGCTYKYLNGGPGSQAFVWVAPQLCDLV 249
                                                   **********************99*************************999*******999999 PP

                                     TIGR01814 252 rlalwwwhekskrfkmeeklelrp..aafrlsnppvlsvaalka.LelfdqaslealRkkSllLT 313
                                                    ++l+ w  +s +f+m +  e++   a +   ++p++s+a++++ Le+f+q+++  lR+kSl+LT
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935 250 TQPLSGWFGHSRQFDMASGYEPSSgiARYLCGTQPITSLAMVECgLEIFAQTDMPSLRRKSLALT 314
                                                   88765555555666666666666665889999********************************* PP

                                     TIGR01814 314 dyleeLvkarlayklvleiitPedtaer.sqlslkfskedkavlkalkkrdvviDkRePnviRla 377
                                                   d++++Lv++r+a    l++itP+++a+r s++s++++ + +av++al++++v+ D+ReP ++R+ 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935 315 DLFIQLVEQRCAA-HDLKLITPREHARRgSHVSFEHP-QGYAVIQALIAQGVIGDYREPRIMRFG 377
                                                   ************8.69*********************.*************************** PP

                                     TIGR01814 378 PvpLYntfkDvykavevleeile 400
                                                    +pLY++f++v++av++l eil+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05935 378 FTPLYTSFTEVFDAVQILGEILD 400
                                                   ********************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (416 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.02
# Mc/sec: 7.78
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory