Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate AO353_24830 AO353_24830 enoyl-CoA hydratase
Query= SwissProt::Q0AVM1 (260 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24830 Length = 263 Score = 147 bits (370), Expect = 3e-40 Identities = 88/259 (33%), Positives = 138/259 (53%), Gaps = 4/259 (1%) Query: 5 NIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSFVA 64 +++ + E +A + +NR NAL+ TL + + N DPAV ++++TGSG +SF A Sbjct: 6 SLLSQVEAGVAWITLNRTAQRNALDIPTLKNLHALLDDFNADPAVRVVVLTGSG-RSFCA 64 Query: 65 GADIAFMQNLSAMEAREFGALGQKVFRLIE---AMEKPVIAAVNGFALGGGCELAMCCDF 121 GAD+A A A E + L+ +++KP IAA+NG A+G G +L +CCD Sbjct: 65 GADLAEWAEAEARGALESYGWTETAHALMSRLYSLDKPTIAAINGTAVGAGMDLTLCCDL 124 Query: 122 RIAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLVNK 181 RIA +A+F + +P G + LPRL+G AK+LL+ ++ AD A GLV++ Sbjct: 125 RIAGQSARFKAGYTSMAYSPDAGASWHLPRLIGTEQAKRLLFLDELWGADRALAAGLVSE 184 Query: 182 VVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIEADAFGLCFATQD 241 V E+LL ++A R+ + A +K EG Q + + E A LC ++D Sbjct: 185 VCADEQLLGAASELATRLANGPTFAFAQTKKLMREGAQRSLPEQLHAELAAGLLCGRSED 244 Query: 242 QKEGMTAFLEKRKANFISK 260 E + A +EKR F+ K Sbjct: 245 GAEALRAAMEKRPPQFVGK 263 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 263 Length adjustment: 25 Effective length of query: 235 Effective length of database: 238 Effective search space: 55930 Effective search space used: 55930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory