Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate AO353_19865 AO353_19865 alcohol dehydrogenase
Query= CharProtDB::CH_000596 (353 letters) >FitnessBrowser__pseudo3_N2E3:AO353_19865 Length = 327 Score = 96.3 bits (238), Expect = 1e-24 Identities = 66/191 (34%), Positives = 96/191 (50%), Gaps = 9/191 (4%) Query: 9 MKAAVMHNTRE-IKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEKPFI 67 M+A V+ + ++ E +P + ++LIKV+A G+C +DLH +G + + P + Sbjct: 1 MRAMVLQTPGQPLQREERAIPTPDAQQLLIKVLACGVCRTDLHL-VDGELPQATL--PRV 57 Query: 68 LGHECAGEIAAVGSSVDQFKVGDRVAVE-PGVTCGRCEACKEGRYNLCPDVQFLATPPVD 126 GHE GE+ AVG+ V +G RV V G TCGRCE C+ GR NLC QF +D Sbjct: 58 PGHEIVGEVTAVGADVAPDWIGQRVGVPWLGSTCGRCEFCRSGRENLCDQAQFTGC-NLD 116 Query: 127 GAFVQYIKMRQDFVFLIPDSLSYEEAA-LIEPFSVGIHAAARTKLQPGSTIAIMGMGPVG 185 G + Y F F +PD+LS EAA L+ +G A K + + G G Sbjct: 117 GGYADYTVADARFCFRLPDTLSATEAAPLLCAGLIGFRALQMAK--TARHLGLYGFGAAA 174 Query: 186 LMAVAAAKAFG 196 +A+ A G Sbjct: 175 HLAIQVALGRG 185 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 327 Length adjustment: 28 Effective length of query: 325 Effective length of database: 299 Effective search space: 97175 Effective search space used: 97175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory