Align FAA hydrolase family protein (characterized, see rationale)
to candidate AO353_08500 AO353_08500 hypothetical protein
Query= uniprot:A0A2E7P912 (281 letters) >FitnessBrowser__pseudo3_N2E3:AO353_08500 Length = 221 Score = 107 bits (268), Expect = 2e-28 Identities = 68/207 (32%), Positives = 109/207 (52%), Gaps = 13/207 (6%) Query: 70 IGKFICIGLNYADHAAESNLPIPAEPVVFNKWTSAVVGPNDDVKIPRGSKKTDWEVELGV 129 +GK +CIG NYA+HA E + P+P EP++F K S VV IP +E E+ V Sbjct: 17 VGKVVCIGRNYAEHAKELDNPVPTEPLLFIKPGSCVVPLEGGFAIPTERGSVHYEAEIAV 76 Query: 130 VIGKG-GSYIDEKDAMSHVAGYCVVNDVSEREYQIE---RGGTWDKGKGCDTFGPIGPWL 185 +IGK + ++ + ++G+ D++ R+ Q E +G W+ K D + P++ Sbjct: 77 LIGKPLSTKPSREEVLDAISGFAPGLDLTLRDKQAELKSKGLPWEISKSFDGACVLAPFV 136 Query: 186 VTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPGDVISTGTPP 245 V+ D +G+ L ++G+ Q+GN+S M+ + ++ Y++ SLQ GDVI TGTP Sbjct: 137 VS-STFPDLTDIGIRLTINGEVRQDGNSSLMLNPIVPMIQYMAGCFSLQAGDVIMTGTPA 195 Query: 246 GVGMGVKPEAVYLRAGQTMRLGIDGLG 272 GVG L G + L + G G Sbjct: 196 GVGP--------LNVGDELVLELPGAG 214 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 221 Length adjustment: 24 Effective length of query: 257 Effective length of database: 197 Effective search space: 50629 Effective search space used: 50629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory