Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate AO353_14720 AO353_14720 aldo/keto reductase
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__pseudo3_N2E3:AO353_14720 Length = 335 Score = 178 bits (452), Expect = 2e-49 Identities = 113/311 (36%), Positives = 170/311 (54%), Gaps = 19/311 (6%) Query: 26 VALGTWAIGG----WMWGGTDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIK 81 + LGTWAI G + WG DD S+ + A++ G+N IDTA YG GHAE++VG+ ++ Sbjct: 16 IGLGTWAIAGTGWEYSWGAQDDKDSLSALEYAVERGVNWIDTAAVYGLGHAEQLVGQLLR 75 Query: 82 ---GQRDNLIIATKVGLDWTLTPDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQVHWP 138 R L+ TK L W +++ + + + EI+ SLRRL + IDLYQ+HWP Sbjct: 76 RVPASRRPLVF-TKGSLVWDPVT-KTISHSLAPQSLLAEIDASLRRLQVETIDLYQIHWP 133 Query: 139 D-----PLVPIEETATILEALRKEGKIRSIGVSNYSVQQMDEFKKYAELAVSQSPYNLFE 193 IE + L R +GKIR+IGVSN++V Q+ + E+ Q PY+ Sbjct: 134 AFPADASSEGIEMALSALATARDQGKIRAIGVSNFNVAQLKRAQAVTEIVSLQPPYSALM 193 Query: 194 REIDKDILPYAKKNDLVVLGYGALCRGLLSGRMTADR--AFTGDDLRKT-DPKFQKPRFE 250 R+I+KD+LP+ ++ + VL Y L GLLSG MT +R DD RK FQ+PR Sbjct: 194 RDIEKDVLPFCERAGMGVLAYSTLQSGLLSGSMTRERILQLPEDDWRKARSADFQEPRLS 253 Query: 251 HYLAAVEELKKLAKEHYNKSVLALAIRWMLEQG-PTLALWGACKPEQIDGIDEVFGWQIS 309 LA V+ + ++ + H S A+AI W+L + T A+ GA +P Q+DG+ ++ Sbjct: 254 ANLALVDVMARIGERH-GVSAAAVAIAWVLRKPVVTGAIVGARRPSQVDGLIAASDLRLD 312 Query: 310 DEDLKQIDAIL 320 ++ +I L Sbjct: 313 TAEIDEIRPFL 323 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 335 Length adjustment: 28 Effective length of query: 312 Effective length of database: 307 Effective search space: 95784 Effective search space used: 95784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory