GapMind for catabolism of small carbon sources

 

Protein AO356_05185 in Pseudomonas fluorescens FW300-N2C3

Annotation: AO356_05185 sugar ABC transporter permease

Length: 281 amino acids

Source: pseudo5_N2C3_1 in FitnessBrowser

Candidate for 21 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
D-glucose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
lactose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
D-maltose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
sucrose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
trehalose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
D-xylose catabolism gtsC hi ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 97% 100% 544.3 ABC transporter for D-Galactose and D-Glucose, permease component 2 87% 498.4
D-galactose catabolism PfGW456L13_1896 hi ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized) 87% 100% 498.4 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 51% 295.8
D-cellobiose catabolism SMc04257 med ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized) 51% 94% 295 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
D-mannose catabolism TT_C0326 med Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 49% 100% 265.4 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
L-arabinose catabolism xacI lo Xylose/arabinose import permease protein XacI (characterized, see rationale) 34% 94% 171 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
D-cellobiose catabolism msdB2 lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 33% 93% 128.6 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
D-cellobiose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
D-glucose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
lactose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
D-maltose catabolism aglG lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
D-maltose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
sucrose catabolism aglG lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
sucrose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
trehalose catabolism aglG lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3
trehalose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 54% 115.5 ABC transporter for D-Glucose-6-Phosphate, permease component 1 97% 544.3

Sequence Analysis Tools

View AO356_05185 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MTSLAAKPSISLSRIAIYAVLILAVLLYLVPLVVMLLTSFKTPEDISTGNLLSWPTVVSG
IGWVKAWATVDGYFWNSIKITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFL
PFQTVLLPASFTLGKMGLASTTTGLVFVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDG
AGFFTIFRRIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTST
GAKEYNVDMAAAMIAGLPTLLVYVVAGKYFVRGLTAGAVKG

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory