GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Pseudomonas fluorescens FW300-N2C3

Align Acetyl-coenzyme A synthetase (EC 6.2.1.1) (characterized)
to candidate AO356_16045 AO356_16045 acetyl-CoA synthetase

Query= reanno::pseudo5_N2C3_1:AO356_18695
         (651 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 AO356_16045
           acetyl-CoA synthetase
          Length = 645

 Score =  820 bits (2119), Expect = 0.0
 Identities = 398/640 (62%), Positives = 479/640 (74%), Gaps = 5/640 (0%)

Query: 5   SLYPVRPEVAASTLTDEATYKAMYQQSVVNPDGFWREQAKR-LDWIKPFTTVKQTSFDDH 63
           S YP    V  +    +  YK +Y++S+ +P  FW EQA R LDW+ P+ TV++  +D  
Sbjct: 5   SQYPHADAVRRAAQLSQDEYKRLYKESIEHPSAFWAEQATRFLDWMTPWQTVQR--YDLK 62

Query: 64  HVDIKWFADGTLNVSYNCLDRHLAERGDQIAIIWEGDDPSESRNITYRELHEEVCKFANA 123
           + D  WFA G LNVS NC+DRHL  RG+Q+AIIWEGD+P+ES  ITY++LH  VC+ AN 
Sbjct: 63  NGDATWFAGGKLNVSANCIDRHLDTRGEQVAIIWEGDNPAESAQITYKKLHNHVCRLANV 122

Query: 124 LRGQDVHRGDVVTIYMPMIPEAVVAMLACTRIGAIHSVVFGGFSPEALAGRIIDCKSKVV 183
           L+ + V +GD V IYMPMIPEA  AMLACTRIGA+HSVVFGGFSP++L  RI+D   + V
Sbjct: 123 LKSRGVKKGDRVCIYMPMIPEAAYAMLACTRIGAVHSVVFGGFSPDSLRDRILDADCRTV 182

Query: 184 ITADEGVRAGKKIPLKANVDDALTNPETSSIQKVIVCKRTAGNIKWNQHRDIWYEDLMKV 243
           ITADEGVR G+ IPLK NVD AL +    ++  V+V +RT G + W + RD+WY   M  
Sbjct: 183 ITADEGVRGGRFIPLKRNVDKALES--CPNVSTVLVVERTQGEVGWVEGRDLWYHQAMHD 240

Query: 244 AGTVCAPKEMGAEEALFILYTSGSTGKPKGVQHTTAGYLLYAALTHERVFDYKPGEVYWC 303
               C P+ M AE+ LFILYTSGSTGKPKGV HTT GYLL AA+T + V DY+  EV+WC
Sbjct: 241 MSDDCPPEPMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLQAAMTFKYVLDYRDNEVFWC 300

Query: 304 TADVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVAKVIDKHKVSILYTAPTAIRA 363
           TADVGWVTGHSYIVYGPLANGATTL+FEGVP++P  +R  +VIDKH+V+I YTAPTA+RA
Sbjct: 301 TADVGWVTGHSYIVYGPLANGATTLIFEGVPSHPSSSRFWQVIDKHQVNIFYTAPTALRA 360

Query: 364 MMASGTAAVEGADGSSLRLLGSVGEPINPEAWDWYYKNVGKERCPIVDTWWQTETGGVLI 423
           +M  G   ++     SLRLLGSVGEPINPEAW+WY+  VG++RCPIVDTWWQTETGG+++
Sbjct: 361 LMREGAGPLQETSRKSLRLLGSVGEPINPEAWEWYFNVVGEQRCPIVDTWWQTETGGIML 420

Query: 424 SPLPGATALKPGSATRPFFGVVPALVDNLGNLIEGAAEGNLVILDSWPGQARTLYGDHDR 483
           SPL  A  LKPG ATRP FGV P L+D +G  I GA  G L I  SWPGQ R++YGDH R
Sbjct: 421 SPLVSAPRLKPGCATRPMFGVQPVLLDEVGKEISGAGSGVLAIKSSWPGQIRSVYGDHQR 480

Query: 484 FVDTYFKTFSGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVA 543
            VDTYFK + G YFTGDGARRDEDG YWITGR+DDV+NVSGHR+GTAE+ESA+V H  +A
Sbjct: 481 MVDTYFKPYPGYYFTGDGARRDEDGDYWITGRIDDVINVSGHRIGTAEVESALVLHDNIA 540

Query: 544 EAAVVGVPHDIKGQGIYVYVTLNAGEETSEALRLELKNWVRKEIGPIASPDVIQWAPGLP 603
           EAAVVG PHD+KGQGIY +VT   G E ++ L+ EL   V KEIG  A P++IQWAP LP
Sbjct: 541 EAAVVGYPHDLKGQGIYAFVTPMNGVEANDELKKELLAHVSKEIGSFAKPELIQWAPALP 600

Query: 604 KTRSGKIMRRILRKIATAEYDGLGDISTLADPGVVAHLIE 643
           KTRSGKIMRRILRKIA  E D LGD STLADP VV  LI+
Sbjct: 601 KTRSGKIMRRILRKIACNELDSLGDTSTLADPSVVEGLID 640


Lambda     K      H
   0.318    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1350
Number of extensions: 72
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 651
Length of database: 645
Length adjustment: 38
Effective length of query: 613
Effective length of database: 607
Effective search space:   372091
Effective search space used:   372091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate AO356_16045 AO356_16045 (acetyl-CoA synthetase)
to HMM TIGR02188 (acs: acetate--CoA ligase (EC 6.2.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02188.hmm
# target sequence database:        /tmp/gapView.27666.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02188  [M=629]
Accession:   TIGR02188
Description: Ac_CoA_lig_AcsA: acetate--CoA ligase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
          0 1027.5   0.0          0 1027.3   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045  AO356_16045 acetyl-CoA synthetas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045  AO356_16045 acetyl-CoA synthetase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1027.3   0.0         0         0       3     628 ..      20     640 ..      18     641 .. 0.99

  Alignments for each domain:
  == domain 1  score: 1027.3 bits;  conditional E-value: 0
                                       TIGR02188   3 eleeykelyeeaiedpekfwaklakeelewlkpfekvldeslep.kvkWfedgelnvsyncvd 64 
                                                     +++eyk+ly+e+ie+p++fwa++a++ l+w++p+++v++ +l++ +++Wf++g+lnvs+nc+d
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045  20 SQDEYKRLYKESIEHPSAFWAEQATRFLDWMTPWQTVQRYDLKNgDATWFAGGKLNVSANCID 82 
                                                     5799*************************************9999****************** PP

                                       TIGR02188  65 rhvekrkdkvaiiwegdeegedsrkltYaellrevcrlanvlkelGvkkgdrvaiYlpmipea 127
                                                     rh+ +r ++vaiiwegd++ e s ++tY++l+++vcrlanvlk+ Gvkkgdrv+iY+pmipea
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045  83 RHLDTRGEQVAIIWEGDNPAE-SAQITYKKLHNHVCRLANVLKSRGVKKGDRVCIYMPMIPEA 144
                                                     *****************9996.***************************************** PP

                                       TIGR02188 128 viamlacaRiGavhsvvfaGfsaealaeRivdaeaklvitadeglRggkvielkkivdealek 190
                                                     ++amlac+RiGavhsvvf+Gfs+++l++Ri da++++vitadeg+Rgg+ i+lk++vd+ale+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 145 AYAMLACTRIGAVHSVVFGGFSPDSLRDRILDADCRTVITADEGVRGGRFIPLKRNVDKALES 207
                                                     *************************************************************** PP

                                       TIGR02188 191 aeesvekvlvvkrtgeevaewkegrDvwweelvekeasaecepekldsedplfiLYtsGstGk 253
                                                     ++ +v++vlvv+rt+ ev  w+egrD+w+++++++  s++c+pe++d+edplfiLYtsGstGk
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 208 CP-NVSTVLVVERTQGEVG-WVEGRDLWYHQAMHD-MSDDCPPEPMDAEDPLFILYTSGSTGK 267
                                                     *9.6*************76.**************7.*************************** PP

                                       TIGR02188 254 PkGvlhttgGylllaaltvkyvfdikdedifwCtaDvGWvtGhsYivygPLanGattllfegv 316
                                                     PkGvlhttgGyll+aa+t+kyv d++d+++fwCtaDvGWvtGhsYivygPLanGattl+fegv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 268 PKGVLHTTGGYLLQAAMTFKYVLDYRDNEVFWCTADVGWVTGHSYIVYGPLANGATTLIFEGV 330
                                                     *************************************************************** PP

                                       TIGR02188 317 ptypdasrfweviekykvtifYtaPtaiRalmklgeelvkkhdlsslrvlgsvGepinpeawe 379
                                                     p++p++srfw+vi+k++v+ifYtaPta+Ralm++g   +++++++slr+lgsvGepinpeawe
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 331 PSHPSSSRFWQVIDKHQVNIFYTAPTALRALMREGAGPLQETSRKSLRLLGSVGEPINPEAWE 393
                                                     *************************************************************** PP

                                       TIGR02188 380 WyyevvGkekcpivdtwWqtetGgilitplpgvatelkpgsatlPlfGieaevvdeegkevee 442
                                                     Wy++vvG+++cpivdtwWqtetGgi+++pl + a  lkpg+at+P+fG++++++de gke++ 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 394 WYFNVVGEQRCPIVDTWWQTETGGIMLSPLVS-APRLKPGCATRPMFGVQPVLLDEVGKEISG 455
                                                     ********************************.69**************************98 PP

                                       TIGR02188 443 eeeggvLvikkpwPsmlrtiygdeerfvetYfkklkglyftGDgarrdkdGyiwilGRvDdvi 505
                                                       + gvL+ik++wP+++r++ygd++r+v+tYfk ++g+yftGDgarrd+dG++wi+GR+Ddvi
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 456 AGS-GVLAIKSSWPGQIRSVYGDHQRMVDTYFKPYPGYYFTGDGARRDEDGDYWITGRIDDVI 517
                                                     777.8********************************************************** PP

                                       TIGR02188 506 nvsGhrlgtaeiesalvsheavaeaavvgvpdeikgeaivafvvlkegveedeeelekelkkl 568
                                                     nvsGhr+gtae+esalv h+++aeaavvg+p+++kg+ i+afv+ ++gve+++e l+kel ++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 518 NVSGHRIGTAEVESALVLHDNIAEAAVVGYPHDLKGQGIYAFVTPMNGVEANDE-LKKELLAH 579
                                                     ****************************************************95.******** PP

                                       TIGR02188 569 vrkeigpiakpdkilvveelPktRsGkimRRllrkiaege.ellgdvstledpsvveelke 628
                                                     v+keig++akp+ i+++++lPktRsGkimRR+lrkia +e ++lgd+stl+dpsvve l++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 580 VSKEIGSFAKPELIQWAPALPKTRSGKIMRRILRKIACNElDSLGDTSTLADPSVVEGLID 640
                                                     *********************************************************9876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (629 nodes)
Target sequences:                          1  (645 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.04
# Mc/sec: 9.10
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory