Align BadH (characterized)
to candidate AO356_27985 AO356_27985 sorbitol dehydrogenase
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27985 Length = 257 Score = 148 bits (373), Expect = 1e-40 Identities = 88/260 (33%), Positives = 135/260 (51%), Gaps = 9/260 (3%) Query: 1 MARLQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAV 60 M RL+ K+A++TG GIG A + + +EGA +A+ D++L+ A A + G +A AV Sbjct: 1 MKRLEGKSALVTGAARGIGRAFAQAYIEEGATVAIADIDLERANATAAEL---GDSAYAV 57 Query: 61 RCDIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALH 120 + D+ D+ S+D AIA G +DIL+NNA P +ERL +IN+ G L Sbjct: 58 KMDVTDQASIDQAIAAVVAQAGKLDILINNAALFDLAPIVDITRQSYERLFSINVAGTLF 117 Query: 121 MHHAVLPGMVERRH-GRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGIT 179 A M+ + H GRI+N+AS A R G + AVY A K +++ +++ + +H I Sbjct: 118 TLQAAARQMIRQGHGGRIINMASQAGRRGEALVAVYCATKAAVISLTQSAGLDLIKHRIN 177 Query: 180 VNVVCPGPTDTALLADVTSGAANPEKLIEAFTK-----AIPLGRLGKPDDLAGAIAFFGS 234 VN + PG D V + A E L + K +P GR+G DL G F S Sbjct: 178 VNAIAPGVVDGEHWDGVDALFARHENLPQGEKKRQVGQQVPYGRMGTAQDLTGMAIFLAS 237 Query: 235 DDAGFITGQVLSVSGGLTMN 254 ++ ++ Q +V GG M+ Sbjct: 238 AESEYVVAQTYNVDGGNWMS 257 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 257 Length adjustment: 24 Effective length of query: 231 Effective length of database: 233 Effective search space: 53823 Effective search space used: 53823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory