Align protocatechuate 3,4-dioxygenase (subunit 1/2) (EC 1.13.11.3) (characterized)
to candidate AO356_04925 AO356_04925 protocatechuate 3,4-dioxygenase
Query= BRENDA::Q0SH26 (213 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_04925 Length = 234 Score = 75.9 bits (185), Expect = 6e-19 Identities = 55/161 (34%), Positives = 78/161 (48%), Gaps = 14/161 (8%) Query: 43 TWENSGDAVPEDAPGRIDVSFSVIDGAGQPIGDAMIETWQADAAGRFNSPTDPRGAAEAT 102 T +++G+ + E RI + V+D GQP+ ++E WQA+AAGR+N D A Sbjct: 63 TAQHAGEPLGE----RIIIHGRVLDEHGQPVPGILVEIWQANAAGRYNHDRDNHDA--PL 116 Query: 103 PAGFRSLARVFADESGTIVVHTVKPGALP--AEDGAVEAPHINVGLFARGMLERLYTRLY 160 F R D G T+KPGA P A HI+ LF +L RL T++Y Sbjct: 117 DPNFTGTGRTVTDADGWYQFQTIKPGAYPWGNHHNAWRPAHIHFSLFGPSILTRLVTQMY 176 Query: 161 FPEDTDAHASDPVLSAVPEAD-RPKLIA----EKTDRGYHL 196 FP D DP+ + VP+ + +LI+ EKT Y L Sbjct: 177 FPGD-PLLEYDPIYNCVPDTSAKERLISSFDLEKTIPNYAL 216 Lambda K H 0.317 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 234 Length adjustment: 22 Effective length of query: 191 Effective length of database: 212 Effective search space: 40492 Effective search space used: 40492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory