Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate AO356_18225 AO356_18225 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_18225 Length = 248 Score = 90.1 bits (222), Expect = 6e-23 Identities = 47/129 (36%), Positives = 81/129 (62%), Gaps = 1/129 (0%) Query: 244 LALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVIIPP 303 L++ + L ++TAA + E VR+GI+++ GQ AAR++G + V++PQA R+IIPP Sbjct: 112 LSVVVCLGLFTAARVCEQVRTGIQALPRGQESAARAMGFKLPQIYWNVLLPQAYRIIIPP 171 Query: 304 LTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISISLLM 363 LTS++LN+ KNSS+A+ IG E+++ T + E + +Y +++S+ LLM Sbjct: 172 LTSEFLNVFKNSSVASLIGLMELLAQTKQTA-EFSANLFEAFTLATLIYFTLNMSLMLLM 230 Query: 364 NWYNKRIAL 372 K++A+ Sbjct: 231 RMVEKKVAV 239 Score = 62.8 bits (151), Expect = 1e-14 Identities = 29/71 (40%), Positives = 46/71 (64%) Query: 59 ADSYARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPP 118 ++ Y +L GL T+ + + I+A +LG ++GV R N ++S +AT YVE+FRN+P Sbjct: 18 SEIYLDWYLAGLGWTIAIAVVAWIIALLLGSLLGVMRTVPNRLVSGIATCYVELFRNVPL 77 Query: 119 LLQILFWYFAV 129 L+Q+ WYF V Sbjct: 78 LVQLFIWYFLV 88 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 375 Length of database: 248 Length adjustment: 27 Effective length of query: 348 Effective length of database: 221 Effective search space: 76908 Effective search space used: 76908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory