GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagPcb in Pseudomonas fluorescens FW300-N2C3

Align PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized)
to candidate AO356_17535 AO356_17535 PTS N-acetyl-D-glucosamine transporter

Query= SwissProt::O34521
         (452 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_17535 AO356_17535 PTS
           N-acetyl-D-glucosamine transporter
          Length = 571

 Score =  461 bits (1186), Expect = e-134
 Identities = 231/454 (50%), Positives = 313/454 (68%), Gaps = 9/454 (1%)

Query: 5   LQKLGKSFMLPIAVLPAVGIILALGREDVFNIPFVYQAGTAVFDHLPLIFAIGIAIGISK 64
           LQ+LG++ MLPIA+LP  G++L LG  D+ +I  ++ AG A+F +L +IFAIGIA+G ++
Sbjct: 9   LQRLGRALMLPIAILPIAGLLLRLGDTDLLDIAIIHDAGQAIFANLAMIFAIGIAVGFAR 68

Query: 65  DSNGAAGLSGAISYLMLDAATKTIDKTNNMAVFGGIIAGLIAGYTYNRFKDTKLPEYLGF 124
           D+NG AGL+GAI YL++ A  K +D + NM +  GII+GL+AG  YNRFKD KLPEYL F
Sbjct: 69  DNNGTAGLAGAIGYLVMIATLKVLDASINMGMLAGIISGLLAGALYNRFKDIKLPEYLAF 128

Query: 125 FSGRRLVPILTAIITIILAGIFGVVWPPIQSCINSFGEWMLGLGGIGAGIFGLFNRLLIP 184
           F GRR VPI+T    + L  +FG++WPPIQ  IN FG  ++  G  GA +FG+FNRLLI 
Sbjct: 129 FGGRRFVPIVTGFSAVGLGVVFGLIWPPIQQGINGFGALLMESGSFGAFVFGVFNRLLIV 188

Query: 185 LGLHHVLNNIFWFQFGEYNG------VTGDLARFFAKDPTAGTYMTGFFPIMMFGLPAAC 238
            GLHH+LNN+ WF FG +        VTGDL+R+FA DP  G +MTG FP+M+FGLPAAC
Sbjct: 189 TGLHHILNNMAWFIFGSFTDPATGAVVTGDLSRYFAGDPKGGQFMTGMFPVMLFGLPAAC 248

Query: 239 LAMVVTAKPSKRKATAGMMIGFALTAFITGITEPIEFAFMFLSPLLYAVHAVLTGLSLFI 298
           LAM   A P +RK   G+++  ALT+F+TG+TEPIEFAFMFL+PLL+ VHA+LTG+S+ +
Sbjct: 249 LAMYRNALPQRRKVMGGILLSMALTSFLTGVTEPIEFAFMFLAPLLFLVHALLTGVSMAV 308

Query: 299 VNWLGIRSGFSFSAGAIDYVLSYGIAEKPLLLLLVGICYAAVYFIVFYVLIKALNLKTPG 358
            N LGI  GF+FS G ID VL +G +    L++ VG+ YAA+Y++VF   I+  +LKTPG
Sbjct: 309 TNLLGIHLGFTFSGGFIDMVLGWGKSTNGWLVVPVGLAYAAIYYLVFDFCIRRFDLKTPG 368

Query: 359 REDDDVDEVLDENTVQDVNENIMLKGLGGKENLQTIDHCATRLRLTVKDTALVDEALLKK 418
           RE+    +       ++      ++ LGG +NL TI  C TRLRL + D     +A LK 
Sbjct: 369 REEVPAGD--KPAIAENQRAAAYIQALGGADNLITIGACTTRLRLDMVDRNKASDAQLKA 426

Query: 419 AGAKGVVKSG-GQSVQVIIGPNVEFAAEELRAAV 451
            GA  VV+ G G S+QV++GP  +  A+E+R AV
Sbjct: 427 LGAMAVVRPGNGGSLQVVVGPMADSIADEIRLAV 460


Lambda     K      H
   0.326    0.144    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 698
Number of extensions: 35
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 452
Length of database: 571
Length adjustment: 34
Effective length of query: 418
Effective length of database: 537
Effective search space:   224466
Effective search space used:   224466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory