GapMind for catabolism of small carbon sources

 

Aligments for a candidate for actP in Pseudomonas fluorescens FW300-N2C3

Align Cation/acetate symporter ActP; Acetate permease; Acetate transporter ActP (characterized)
to candidate AO356_19665 AO356_19665 cation/acetate symporter ActP

Query= SwissProt::P32705
         (549 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19665 AO356_19665
           cation/acetate symporter ActP
          Length = 552

 Score =  853 bits (2205), Expect = 0.0
 Identities = 439/552 (79%), Positives = 483/552 (87%), Gaps = 3/552 (0%)

Query: 1   MKRVLTALAATLPFA--ANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVR 58
           M R L AL +   FA  A AADA++GAV++QP N  AI+MF+ FV  TL ITYWASK+  
Sbjct: 1   MIRRLLALLSIAAFAPGAWAADALTGAVQKQPLNVAAILMFVAFVGATLYITYWASKKNN 60

Query: 59  SRSDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIIL 118
           S +DYY AGG ITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYS+GFLVGWPIIL
Sbjct: 61  SAADYYAAGGKITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIIL 120

Query: 119 FLIAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFG 178
           FLIAERLRNLG+YTFADVASYRL Q  IR LSA GSLVVVA YLIAQMVGAGKLI+LLFG
Sbjct: 121 FLIAERLRNLGKYTFADVASYRLGQTQIRTLSASGSLVVVAFYLIAQMVGAGKLIQLLFG 180

Query: 179 LNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLF 238
           L+YH+AV+LVG+LM +YVLFGGMLATTWVQIIKAVLLL GASFMA MVMKHV F FN LF
Sbjct: 181 LDYHVAVILVGILMCLYVLFGGMLATTWVQIIKAVLLLSGASFMALMVMKHVNFDFNMLF 240

Query: 239 SEAMAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSV 298
           +EA+ VHPKG  IM PGGLVKDPISA SLGL LMFGTAGLPHILMRFFTVSDA+EARKSV
Sbjct: 241 AEAVKVHPKGEAIMSPGGLVKDPISAFSLGLALMFGTAGLPHILMRFFTVSDAKEARKSV 300

Query: 299 FYATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLG 358
            YATGF+GYFYILTFIIGFGAI+LV  NP +KDAAG L+GGNNMAAVHLANAVGG++FLG
Sbjct: 301 LYATGFIGYFYILTFIIGFGAILLVSTNPAFKDAAGALLGGNNMAAVHLANAVGGSIFLG 360

Query: 359 FISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKG-ATEREELRVSKITVLILGVIAI 417
           FISAVAFATILAVVAGLTLAGASAVSHDLYA+V KKG A E++E+RVSKIT + L V+AI
Sbjct: 361 FISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKANEKDEIRVSKITTIALAVLAI 420

Query: 418 ILGVLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMI 477
            LG+LFE QNIAFMVGLAF+IAASCNFP++LLSMYW KLTTRGAM+GGWLGL++AV LMI
Sbjct: 421 GLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMIGGWLGLVSAVGLMI 480

Query: 478 LGPTIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRS 537
           LGPTIWVQI+GHEKAIFPYEYPALFS+ +AF+GIWFFS TD SAEGA ER LF  QF+RS
Sbjct: 481 LGPTIWVQIMGHEKAIFPYEYPALFSMAIAFVGIWFFSITDKSAEGANERALFFPQFVRS 540

Query: 538 QTGFGVEQGRAH 549
           QTG G      H
Sbjct: 541 QTGLGASGAVNH 552


Lambda     K      H
   0.329    0.142    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1037
Number of extensions: 44
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 549
Length of database: 552
Length adjustment: 36
Effective length of query: 513
Effective length of database: 516
Effective search space:   264708
Effective search space used:   264708
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory