Align Glyceraldehyde dehydrogenase small chain; Glyceraldehyde dehydrogenase subunit C; Glyceraldehyde dehydrogenase subunit gamma; EC 1.2.99.8 (characterized)
to candidate AO356_26895 AO356_26895 2Fe-2S ferredoxin
Query= SwissProt::Q4J6M5 (163 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_26895 Length = 157 Score = 117 bits (293), Expect = 9e-32 Identities = 64/153 (41%), Positives = 87/153 (56%), Gaps = 5/153 (3%) Query: 14 VRVNGVWYEKYVSPRTLLVDFIRDELGLTGTKVGCDTTTCGACTVIMNGKSVKSCTVLAA 73 + +NG Y V P T ++ +RD LG+TGTK GC CGACTV ++G++++SC A Sbjct: 4 LNINGREYTVDVDPGTPILWTLRDTLGMTGTKFGCGAALCGACTVHLDGQAIRSCVTPIA 63 Query: 74 QADGAEITTIEGLS--SDSKLHPIQEAFKDNFALQCGFCTAGMIMQTYFFLKEHP---NP 128 A G +ITTIE + SD + EA+ + QCG+C +G IM FLK P P Sbjct: 64 AAVGKKITTIEAATDGSDPVGSAVHEAWVKHDVAQCGYCQSGQIMSATAFLKAQPKGKQP 123 Query: 129 TEEEVRDGIHGNICRCTGYQNIVKAVLDASKRL 161 T E+ + GNICRC Y I AV DA+K + Sbjct: 124 TAAEIDSAMAGNICRCGTYARIRAAVADAAKAI 156 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 79 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 157 Length adjustment: 17 Effective length of query: 146 Effective length of database: 140 Effective search space: 20440 Effective search space used: 20440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory