Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate AO356_23210 AO356_23210 ABC transporter
Query= CharProtDB::CH_014278 (328 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23210 Length = 340 Score = 179 bits (453), Expect = 1e-49 Identities = 102/282 (36%), Positives = 168/282 (59%), Gaps = 17/282 (6%) Query: 56 LAISMSGMVACGMLFCLASGDFDLSVASVIACAGVTTA-----------VVINLTE-SLW 103 L +S+ G++A G+ + + DLS SV+A + + A V +LT+ +W Sbjct: 61 LQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVW 120 Query: 104 IGVAAGLLLGVLCGLVNGFVIAKLKINALITTLATMQIVRGLAYIISDGKAVGIEDESFF 163 I V AGL +G+L G +NG +IA I I TL M RGLA ++G+ V + +S+ Sbjct: 121 IPVVAGLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYT 180 Query: 164 ALGYANWFGLPAPIWLTVACLIIFGLLLNKTTFGRNTLAIGGNEEAARLAGVPVVRTKII 223 A+G+ +P I+L VA +IF + L T +G+ T AIGGN +AAR +G+ V R +I Sbjct: 181 AIGHG---AMPVIIFLVVA--VIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVI 235 Query: 224 IFVLSGLVSAIAGIILASRMTSGQPMTSIGYELIVISACVLGGVSLKGGIGKISYVVAGI 283 ++ ++GL++ +AG++ ++R +GQ + YEL I+A V+GG SL GG+G+I+ V G Sbjct: 236 VYSIAGLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGA 295 Query: 284 LILGTVENAMNLLNISPFAQYVVRGLILLAAVIFDRYKQKAK 325 LILG + + + + + Q +++GLI++ AV+ D+Y+ K K Sbjct: 296 LILGVMASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNKRK 337 Lambda K H 0.327 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 340 Length adjustment: 28 Effective length of query: 300 Effective length of database: 312 Effective search space: 93600 Effective search space used: 93600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory