Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate AO356_10300 AO356_10300 3-phosphoglycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_10300 Length = 409 Score = 169 bits (427), Expect = 1e-46 Identities = 101/293 (34%), Positives = 157/293 (53%), Gaps = 14/293 (4%) Query: 35 PRGVLLEKVREVDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVT 94 P L EK+ + + ++ +E+ ++A KL + + +G + +D+ A +RGI V Sbjct: 43 PEAQLKEKIADAHFIGIRSRTQLTEEIFDHAKKLVAVGCFCIGTNQVDLNAARERGIAVF 102 Query: 95 NTPGVLTDATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLG 154 N P T + A+L A + + R I E +A G W KS + ++GK LG Sbjct: 103 NAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAAN-------SFEIRGKKLG 155 Query: 155 IVGFGRIGQALAKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPL 214 IVG+G IG L+ A+G GM++ +Y K + D LL SD ++LHVP Sbjct: 156 IVGYGSIGTQLSVLAEGLGMQVFFYDTVTKLPLGN--ATQVNDLHELLGMSDIVTLHVPE 213 Query: 215 TKETYHMIGEKELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYN 274 T T MIGEKE++ +K ILIN +RG VV +AL +A+K+ + GA +DVF EP N Sbjct: 214 TAATQWMIGEKEIRAIKKGGILINAARGTVVKLDALAEAIKDKHLIGAAIDVFPVEPRSN 273 Query: 275 EELFK-----LKNVVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPNLVN 322 +++F+ L NV+L PHIG +T EA+ + VA+ L+ ++ + VN Sbjct: 274 DDIFESPLRGLDNVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVN 326 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 409 Length adjustment: 30 Effective length of query: 301 Effective length of database: 379 Effective search space: 114079 Effective search space used: 114079 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory