Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate AO356_24380 AO356_24380 hydroxyacid dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_24380 Length = 317 Score = 171 bits (433), Expect = 2e-47 Identities = 116/309 (37%), Positives = 161/309 (52%), Gaps = 22/309 (7%) Query: 23 YEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNID 82 Y +EL P A + + E A++T + E + P L+II GY+ +D Sbjct: 24 YHLELAPTP-AERKTAIFEHGERFSAVLTRGPLGLTAEEIGALPNLQIICVIGAGYEQVD 82 Query: 83 IEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLM 142 ++ A +RGI VTN GV + AD A ALLLA+ R I ADA VR GEW K Sbjct: 83 LQAARQRGIVVTNGAGVNASSVADHAMALLLALVRDIPRADASVRRGEWAK--------- 133 Query: 143 FLGYGLKGKTLGIVGFGRIGQALAKRAK-GFGMKIIYYSRTRKPEAEEEIGAEYVDFETL 201 + L GK LG++G G +G A+AKRA GF M + Y++R + + A + L Sbjct: 134 VMRPSLAGKRLGVLGLGAVGMAIAKRAALGFDMSVSYHNRRLRNDVPYTFCATPTE---L 190 Query: 202 LKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAG 261 + SDF+ + P +T +I ++ L + P+ L+N +R +VV T LI AL++ IAG Sbjct: 191 ARVSDFLIVATPGGLDTRQLINKQALDALGPHGFLVNIARASVVATADLISALEQRRIAG 250 Query: 262 AGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPNLV 321 A LDVF+ EP + L L NVVL PH+ + EA G ELV +NL AF G Sbjct: 251 AALDVFDHEPEVPDALKNLPNVVLTPHVAGLSPEATRGTVELVGQNLNAFFAG------- 303 Query: 322 NKDVLTSSP 330 K VLT P Sbjct: 304 -KPVLTPVP 311 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 317 Length adjustment: 28 Effective length of query: 303 Effective length of database: 289 Effective search space: 87567 Effective search space used: 87567 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory