Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate AO356_27985 AO356_27985 sorbitol dehydrogenase
Query= reanno::ANA3:7024897 (256 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27985 Length = 257 Score = 123 bits (308), Expect = 4e-33 Identities = 84/259 (32%), Positives = 134/259 (51%), Gaps = 23/259 (8%) Query: 10 LQGKTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVTFYH 69 L+GK+ ++G A GIG A++E+GA VA DI +E + A+L + + Sbjct: 4 LEGKSALVTGAARGIGRAFAQAYIEEGATVAIADIDLERANATAAELGDSAYAVKM---- 59 Query: 70 CDLVDIAALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLNTNLRHYFFA 129 D+ D A++ + IA V G + +LINNAA I ++T + +++ + N+ F Sbjct: 60 -DVTDQASIDQAIAAVVAQAGKLDILINNAALFDLAPIVDITRQSYERLFSINVAGTLFT 118 Query: 130 VQAVRPQMQRLG-GGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRI 188 +QA QM R G GG +IN+ S + +A +A Y A+KA + LT+ DL K +I + Sbjct: 119 LQAAARQMIRQGHGGRIINMASQAGRRGEALVAVYCATKAAVISLTQSAGLDLIKHRINV 178 Query: 189 NTLTPGWVMTKRQLTHW--VDKDTAKHI-----ENNQCIKEYV------MPEDIAAMALF 235 N + PG V + HW VD A+H E + + + V +D+ MA+F Sbjct: 179 NAIAPGVVDGE----HWDGVDALFARHENLPQGEKKRQVGQQVPYGRMGTAQDLTGMAIF 234 Query: 236 LAADDSKLCTAQNFIVDGG 254 LA+ +S+ AQ + VDGG Sbjct: 235 LASAESEYVVAQTYNVDGG 253 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 257 Length adjustment: 24 Effective length of query: 232 Effective length of database: 233 Effective search space: 54056 Effective search space used: 54056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory