GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcA in Pseudomonas fluorescens FW300-N2C3

Align arginine deiminase (EC 3.5.3.6) (characterized)
to candidate AO356_05270 AO356_05270 arginine deiminase

Query= BRENDA::P13981
         (418 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270 AO356_05270 arginine
           deiminase
          Length = 418

 Score =  723 bits (1867), Expect = 0.0
 Identities = 347/418 (83%), Positives = 382/418 (91%)

Query: 1   MSTEKTKLGVHSEAGKLRKVMVCSPGLAHQRLTPSNCDELLFDDVIWVNQAKRDHFDFVT 60
           M+TEK K GVHSEAGKLRKVMVCSPGLAHQRLTP+NCDELLFDDVIWVNQAKRDHFDFVT
Sbjct: 1   MTTEKVKYGVHSEAGKLRKVMVCSPGLAHQRLTPNNCDELLFDDVIWVNQAKRDHFDFVT 60

Query: 61  KMRERGIDVLEMHNLLTETIQNPEALKWILDRKITADSVGLGLTSELRSWLESLEPRKLA 120
           KMRERGIDVLEMHNLLT+ +  PEAL WIL RKITA+SVGLGL +E+ SWL SLEPR +A
Sbjct: 61  KMRERGIDVLEMHNLLTDIVAIPEALDWILQRKITANSVGLGLVNEVGSWLRSLEPRHIA 120

Query: 121 EYLIGGVAADDLPASEGANILKMYREYLGHSSFLLPPLPNTQFTRDTTCWIYGGVTLNPM 180
           E+LIGGV+ADDLP S G   ++M+R++LGHSSF+LPPLPNTQFTRDTTCWIYGGVTLNPM
Sbjct: 121 EFLIGGVSADDLPDSFGGKTIQMFRDFLGHSSFILPPLPNTQFTRDTTCWIYGGVTLNPM 180

Query: 181 YWPARRQETLLTTAIYKFHPEFANAEFEIWYGDPDKDHGSSTLEGGDVMPIGNGVVLIGM 240
           YWPARRQETLL +AIYKFHPEF  A+F+IWYGDPD++HG++TLEGGDVMPIGNGVVLIGM
Sbjct: 181 YWPARRQETLLASAIYKFHPEFTQADFQIWYGDPDQEHGNATLEGGDVMPIGNGVVLIGM 240

Query: 241 GERSSRQAIGQVAQSLFAKGAAERVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVKE 300
           GERSSRQAIGQ+A +LF   A ERVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVV +
Sbjct: 241 GERSSRQAIGQLALNLFKHKAVERVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVSQ 300

Query: 301 IVPFSLRPDPSSPYGMNIRREEKTFLEVVAESLGLKKLRVVETGGNSFAAEREQWDDGNN 360
           IV FSLRPD S P G+++RREE +FL+ VA +L L  LRVVETGGNSFAAEREQWDDGNN
Sbjct: 301 IVAFSLRPDESKPGGIDVRREEGSFLDTVAAALKLPALRVVETGGNSFAAEREQWDDGNN 360

Query: 361 VVCLEPGVVVGYDRNTYTNTLLRKAGVEVITISASELGRGRGGGHCMTCPIVRDPIDY 418
           VV +EPGVV+GYDRNTYTNTLLRKAGVEVITISASELGRGRGGGHCMTCPI+RDPIDY
Sbjct: 361 VVAVEPGVVIGYDRNTYTNTLLRKAGVEVITISASELGRGRGGGHCMTCPIIRDPIDY 418


Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 660
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 418
Length adjustment: 32
Effective length of query: 386
Effective length of database: 386
Effective search space:   148996
Effective search space used:   148996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate AO356_05270 AO356_05270 (arginine deiminase)
to HMM TIGR01078 (arcA: arginine deiminase (EC 3.5.3.6))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01078.hmm
# target sequence database:        /tmp/gapView.27449.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01078  [M=408]
Accession:   TIGR01078
Description: arcA: arginine deiminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   7.1e-167  541.2   0.0   8.1e-167  541.0   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270  AO356_05270 arginine deiminase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270  AO356_05270 arginine deiminase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  541.0   0.0  8.1e-167  8.1e-167       3     408 .]      10     416 ..       8     416 .. 0.99

  Alignments for each domain:
  == domain 1  score: 541.0 bits;  conditional E-value: 8.1e-167
                                       TIGR01078   3 vysEiGkLkkvllhrPgkelenltPsnldelLFddilavedakkeHdeFveklrdngvevlll 65 
                                                     v+sE+GkL+kv++++Pg ++++ltP+n+delLFdd+++v++ak++H +Fv+k+r++g++vl++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270  10 VHSEAGKLRKVMVCSPGLAHQRLTPNNCDELLFDDVIWVNQAKRDHFDFVTKMRERGIDVLEM 72 
                                                     99************************************************************* PP

                                       TIGR01078  66 edLlaEtlaaseakeklldealeeaeilgeelkkelreylksletrelvekllaGvakeelpe 128
                                                     ++Ll++ +a++ea +++l++++++++ +g +l +e+ ++l+sle+r+++e l++Gv +++lp+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270  73 HNLLTDIVAIPEALDWILQRKITANS-VGLGLVNEVGSWLRSLEPRHIAEFLIGGVSADDLPD 134
                                                     **************************.9*********************************** PP

                                       TIGR01078 129 eedselslvdlevegdsefvidPlPnllFtRDpsasigngvtlnkmalkaRqrEtlftelifk 191
                                                     +   ++ ++ +   g+s+f+++PlPn++FtRD++++i++gvtln+m+++aR++Etl++++i+k
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270 135 SFGGKTIQMFRDFLGHSSFILPPLPNTQFTRDTTCWIYGGVTLNPMYWPARRQETLLASAIYK 197
                                                     *************************************************************** PP

                                       TIGR01078 192 hHpkfanaevevyyd....rsekaslEGGDvlvlskdvlviGiseRtsaqsveklakslfkne 250
                                                     +Hp+f++a+++++y+    ++ +a+lEGGDv+ ++++v++iG++eR+s+q++++la +lfk+ 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270 198 FHPEFTQADFQIWYGdpdqEHGNATLEGGDVMPIGNGVVLIGMGERSSRQAIGQLALNLFKH- 259
                                                     **************999988999***************************************. PP

                                       TIGR01078 251 aefkkvlaiklpkkralmHLDtvltmvDkdkftvfpevekelkafsiysltkgneekikveek 313
                                                     +++++v+++ lpk+ra+mHLDtv++++D+d +tvfpev+++++afs++ +++++ +   ++e+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270 260 KAVERVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVSQIVAFSLRPDESKPGGIDVRREE 322
                                                     99******************************************************9999*** PP

                                       TIGR01078 314 akleevlaealgvkklkliktgGgdsveaeREqwnDgnnvlaiaPGvvvaYeRnvvtnallek 376
                                                      ++ + +a+al++  l++++tg g+s++aeREqw+Dgnnv+a++PGvv++Y+Rn++tn+ll+k
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270 323 GSFLDTVAAALKLPALRVVETG-GNSFAAEREQWDDGNNVVAVEPGVVIGYDRNTYTNTLLRK 384
                                                     *********************9.9*************************************** PP

                                       TIGR01078 377 aGikvltiagseLsrGrGgprCmsmplvRddi 408
                                                     aG++v+ti++seL+rGrGg++Cm++p+ Rd+i
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05270 385 AGVEVITISASELGRGRGGGHCMTCPIIRDPI 416
                                                     *****************************987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (408 nodes)
Target sequences:                          1  (418 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 7.19
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory