Align Arginine N-succinyltransferase subunit alpha; ARUAI; EC 2.3.1.109; AOST; AST (uncharacterized)
to candidate AO356_01525 AO356_01525 arginine N-succinyltransferase
Query= curated2:P80357 (338 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_01525 Length = 338 Score = 380 bits (976), Expect = e-110 Identities = 192/338 (56%), Positives = 245/338 (72%) Query: 1 MLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYF 60 ML +RP Q ADLPQ+QRLA DS VGVTSLPDD RL +KIL S ASFAA+ G E+YF Sbjct: 1 MLALRPVQLADLPQLQRLARDSLVGVTSLPDDTRRLEEKILDSCASFAADAQGPGAENYF 60 Query: 61 FVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGN 120 FVL+D SG LVGCS I++S G +EPFYS RN F SR L+I + + LSLC DL G Sbjct: 61 FVLQDLESGRLVGCSEILSSTGCNEPFYSLRNRPFSSESRELNIQHGVPALSLCQDLNGQ 120 Query: 121 SLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAV 180 +LL F++ V++ +EL SR RL+F+A+HP+RFA++V+ EIVG+S E G+SPFW+A+ Sbjct: 121 TLLRGFHIDAGRVRTPESELLSRARLMFIAAHPQRFAESVITEIVGFSSEDGQSPFWDAI 180 Query: 181 GRNFFDLNYIEAEKLSGLKSRTFLAELMPHYPIYVPLLPDAAQESMGQVHPRAQITFDIL 240 G++FFDL Y+EAE+L GL+SRTFLAELMP YPIYVP+LP AAQ +G+VHP Q FDIL Sbjct: 181 GQHFFDLPYVEAERLCGLQSRTFLAELMPQYPIYVPMLPPAAQACIGRVHPDGQEAFDIL 240 Query: 241 MREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEAPKSGRPYLVTNGQLQDF 300 REGFET++Y+DIFDGGPTLHAR + IRSI QSR + + YLV+N L + Sbjct: 241 EREGFETNSYVDIFDGGPTLHARIANIRSITQSRTTTARQSPQIDARGLYLVSNEHLASY 300 Query: 301 RAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAV 338 RA+V +LD PVALS AL + +GA +R++A+ Sbjct: 301 RAIVAELDVGADGPVALSPAMLTALDIQDGARIRVIAL 338 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 338 Length adjustment: 28 Effective length of query: 310 Effective length of database: 310 Effective search space: 96100 Effective search space used: 96100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory