Align Arginine N-succinyltransferase; AST; AOST; EC 2.3.1.109 (characterized)
to candidate AO356_01530 AO356_01530 arginine N-succinyltransferase
Query= SwissProt::Q8ZPV1 (344 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_01530 Length = 344 Score = 307 bits (787), Expect = 2e-88 Identities = 159/335 (47%), Positives = 216/335 (64%), Gaps = 2/335 (0%) Query: 3 VIRPVEHADIAALMQLAGKTGGGLTSLPANEATLAARIERALKTWSGELPKGEQGYVFVL 62 ++RPV D+ AL+ LA G G TSLPANE LA R+ A +T++G++ + + Y+FVL Sbjct: 2 IVRPVALTDLPALLDLARCAGPGFTSLPANEERLAHRVRWAQRTFAGQVERADADYLFVL 61 Query: 63 EDSETGEVGGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSEL 122 ED + +V GI A+ AVGL +PWYNYRVG V ++ EL + +PTLFL+N+ +G SE+ Sbjct: 62 EDDDR-QVVGISALTGAVGLREPWYNYRVGVTVSSAPELGIQRQIPTLFLNNEMSGQSEI 120 Query: 123 CTLFLDPEWRKEGNGYLLSKSRFMFMAAFRDKFNEKVVAEMRGVIDEHGYSPFWQSLGKR 182 C+LFL PE R NG LLS +R +F+A F F EK++AE+RG DE G SPFW SLG+ Sbjct: 121 CSLFLHPEQRHGHNGRLLSLARLLFVAEFSQLFGEKLIAELRGHADEQGCSPFWDSLGRH 180 Query: 183 FFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSEEAQAVIGEVHPQTAPARAVLEKE 242 FF DFS AD L G G K+FIAELMP+ P+YT L+E+AQAVIG+ HP T PA +L E Sbjct: 181 FFQKDFSYADQLSGMGNKSFIAELMPRQPLYTCLLTEQAQAVIGKAHPNTEPALKILSAE 240 Query: 243 GFRYRHYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAPGDYPACLVANENYHHFRA 302 GF +R YIDIFDGGP +E + ++R++R S+ + +A G P P L+ N + R Sbjct: 241 GFSHRGYIDIFDGGPVIEAPVSKIRSVRDSQTLTLAIGTP-DEQAPVWLIHNRRLENCRV 299 Query: 303 ALVRADPQTSRLVLTAAQLDALKCRAGDHVRLVRL 337 RA + L++ L+ + GD VR V L Sbjct: 300 TSARARLHGNSLLVDRLTAKRLQVQPGDTVRAVAL 334 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 344 Length adjustment: 29 Effective length of query: 315 Effective length of database: 315 Effective search space: 99225 Effective search space used: 99225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate AO356_01530 AO356_01530 (arginine N-succinyltransferase)
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.26894.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-139 450.0 0.0 2.3e-139 449.9 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 AO356_01530 arginine N-succinylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 AO356_01530 arginine N-succinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 449.9 0.0 2.3e-139 2.3e-139 1 336 [] 2 334 .. 2 334 .. 0.99 Alignments for each domain: == domain 1 score: 449.9 bits; conditional E-value: 2.3e-139 TIGR03244 1 ivrpvktsdldallelakeaGvGltslpaneellekrieraeksfageleraeegylfvledt 63 ivrpv +dl+all+la+ aG G+tslpanee+l++r+ +a+++fag++era+++ylfvled lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 2 IVRPVALTDLPALLDLARCAGPGFTSLPANEERLAHRVRWAQRTFAGQVERADADYLFVLED- 63 79************************************************************. PP TIGR03244 64 etgkvvGvsaieaavGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfld 126 ++ +vvG+sa+ avGl+ep+ynyrvg +v+++ el+i ++++tlfl n++ g+se+C+lfl+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 64 DDRQVVGISALTGAVGLREPWYNYRVGVTVSSAPELGIQRQIPTLFLNNEMSGQSEICSLFLH 126 8999*********************************************************** PP TIGR03244 127 eeyrkelnGkllskarflflaefkerfskkiiaemrGvsdeeGrsPfWealgkkffsldfska 189 +e r+++nG+lls ar+lf+aef+++f++k+iae+rG++de+G sPfW++lg++ff+ dfs a lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 127 PEQRHGHNGRLLSLARLLFVAEFSQLFGEKLIAELRGHADEQGCSPFWDSLGRHFFQKDFSYA 189 *************************************************************** PP TIGR03244 190 dylsgiGkkafiaelmPkfPiyvdllskeaqdvigkvhektkPalalleseGlryqgyvdifd 252 d lsg+G+k+fiaelmP+ P+y++ll+++aq+vigk h++t+Pal++l +eG+ ++gy+difd lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 190 DQLSGMGNKSFIAELMPRQPLYTCLLTEQAQAVIGKAHPNTEPALKILSAEGFSHRGYIDIFD 252 *************************************************************** PP TIGR03244 253 aGptleaevakiravresklvevavaesaaedeaepylvanekledfrvvlvessldaeelvl 315 +Gp++ea v+kir+vr+s+++++a++++ +++ + l++n++le++rv+ ++++l+ ++l++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 253 GGPVIEAPVSKIRSVRDSQTLTLAIGTPDEQA--PVWLIHNRRLENCRVTSARARLHGNSLLV 313 **************************998777..99*************************** PP TIGR03244 316 saeeakalkveeGdkvrvval 336 ++ +ak+l+v+ Gd+vr val lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_01530 314 DRLTAKRLQVQPGDTVRAVAL 334 ******************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory