GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astA in Pseudomonas fluorescens FW300-N2C3

Align Arginine N-succinyltransferase subunit alpha; ARUAI; EC 2.3.1.109; AOST; AST (uncharacterized)
to candidate AO356_18730 AO356_18730 arginine N-succinyltransferase

Query= curated2:P80357
         (338 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730 AO356_18730 arginine
           N-succinyltransferase
          Length = 339

 Score =  571 bits (1472), Expect = e-168
 Identities = 288/339 (84%), Positives = 312/339 (92%), Gaps = 1/339 (0%)

Query: 1   MLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYF 60
           MLVMRPAQ ADL +VQRLAADSP+GVTSLPDD ERL DKI ASEASFAAEVS+NGEESYF
Sbjct: 1   MLVMRPAQMADLGEVQRLAADSPIGVTSLPDDVERLSDKIAASEASFAAEVSFNGEESYF 60

Query: 61  FVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGN 120
           FVLED+A+G+L GCSAIVASAG+SEPFYSFRNETFVHASR L IHNKIHVLS CHDLTGN
Sbjct: 61  FVLEDTATGKLAGCSAIVASAGYSEPFYSFRNETFVHASRELKIHNKIHVLSQCHDLTGN 120

Query: 121 SLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAV 180
           SLLTSFYV  +LV S ++ELNSRGRLLF+ASHPERFAD+VV EIVGYSDE G+SPFW+A+
Sbjct: 121 SLLTSFYVVPELVGSPWSELNSRGRLLFVASHPERFADSVVTEIVGYSDENGDSPFWDAI 180

Query: 181 GRNFFDLNYIEAEKLSGLKSRTFLAELMPHYPIYVPLLPDAAQESMGQVHPRAQITFDIL 240
           GRNFFDLNY  AE+L GLKSRTFLAELMPHYPIYVPLLPDAAQE+MGQVHPRAQITFDIL
Sbjct: 181 GRNFFDLNYAAAERLCGLKSRTFLAELMPHYPIYVPLLPDAAQEAMGQVHPRAQITFDIL 240

Query: 241 MREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEAPK-SGRPYLVTNGQLQD 299
           MREGFETD+YIDIFDGGPTLHAR SGIRSIAQSRVVPVKIGE  K +GR YLV N QLQD
Sbjct: 241 MREGFETDHYIDIFDGGPTLHARVSGIRSIAQSRVVPVKIGEPVKGAGRQYLVANAQLQD 300

Query: 300 FRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAV 338
           +RAV+L+LD+APGKPV L +EAAEALGVGEGASVRLVAV
Sbjct: 301 YRAVLLELDYAPGKPVTLDMEAAEALGVGEGASVRLVAV 339


Lambda     K      H
   0.319    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 445
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 338
Length of database: 339
Length adjustment: 28
Effective length of query: 310
Effective length of database: 311
Effective search space:    96410
Effective search space used:    96410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate AO356_18730 AO356_18730 (arginine N-succinyltransferase)
to HMM TIGR03245 (aruF: arginine/ornithine succinyltransferase, alpha subunit (EC 2.3.1.109))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03245.hmm
# target sequence database:        /tmp/gapView.22258.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03245  [M=336]
Accession:   TIGR03245
Description: arg_AOST_alph: arginine/ornithine succinyltransferase, alpha subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   2.4e-170  552.5   0.0   2.8e-170  552.3   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730  AO356_18730 arginine N-succinylt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730  AO356_18730 arginine N-succinyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  552.3   0.0  2.8e-170  2.8e-170       1     336 []       3     339 .]       3     339 .] 0.99

  Alignments for each domain:
  == domain 1  score: 552.3 bits;  conditional E-value: 2.8e-170
                                       TIGR03245   1 vvrParladldaierlaresaigvtslPadrekleekiaqsessfaaevsfsgeesylfvled 63 
                                                     v+rPa++adl +++rla++s+igvtslP+d e+l +kia+se sfaaevsf+geesy+fvled
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730   3 VMRPAQMADLGEVQRLAADSPIGVTSLPDDVERLSDKIAASEASFAAEVSFNGEESYFFVLED 65 
                                                     79************************************************************* PP

                                       TIGR03245  64 setgkllGtasivasaGyaePfysyrndtlvhasrelkvnnkihvlslsheltGksllasfyv 126
                                                     ++tgkl+G+++ivasaGy+ePfys+rn+t+vhasrelk++nkihvls +h+ltG+sll+sfyv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730  66 TATGKLAGCSAIVASAGYSEPFYSFRNETFVHASRELKIHNKIHVLSQCHDLTGNSLLTSFYV 128
                                                     *************************************************************** PP

                                       TIGR03245 127 dpelreaeaaellsrarllfiaaererfasrviaellGvsdeaGesPfWdaiGrkffdldfaa 189
                                                      pel+++ + el+sr+rllf+a+++erfa++v++e++G sde+G+sPfWdaiGr+ffdl++aa
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730 129 VPELVGSPWSELNSRGRLLFVASHPERFADSVVTEIVGYSDENGDSPFWDAIGRNFFDLNYAA 191
                                                     *************************************************************** PP

                                       TIGR03245 190 verasglksktfiaelmPsyPiyvpllpdeaqealgqvheraelafdlllreGfeadryidif 252
                                                     +er++glks+tf+aelmP+yPiyvpllpd+aqea+gqvh+ra+++fd+l+reGfe+d+yidif
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730 192 AERLCGLKSRTFLAELMPHYPIYVPLLPDAAQEAMGQVHPRAQITFDILMREGFETDHYIDIF 254
                                                     *************************************************************** PP

                                       TIGR03245 253 dgGpvleaeldrlktvkksrekpvkieeaatgg.stylvsnglledfravladlavvdGkalr 314
                                                     dgGp+l+a++++++++++sr++pvki e  +g  ++ylv+n +l+d+ravl++l+ ++Gk+++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730 255 DGGPTLHARVSGIRSIAQSRVVPVKIGEPVKGAgRQYLVANAQLQDYRAVLLELDYAPGKPVT 317
                                                     ****************************999888***************************** PP

                                       TIGR03245 315 lkadaaealgvseGdavrlval 336
                                                     l+++aaealgv+eG++vrlva+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18730 318 LDMEAAEALGVGEGASVRLVAV 339
                                                     *******************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (336 nodes)
Target sequences:                          1  (339 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.95
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory