Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate AO356_16720 AO356_16720 4-aminobutyrate aminotransferase
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_16720 Length = 416 Score = 206 bits (524), Expect = 1e-57 Identities = 144/410 (35%), Positives = 205/410 (50%), Gaps = 49/410 (11%) Query: 28 GEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWHTG-NGYTNEPVLRL 86 G + +WD GK YIDF GGI V LGH HPR+V+A+ EQA + H N + P + L Sbjct: 21 GRNAEVWDTDGKRYIDFVGGIGVLNLGHCHPRIVEAIREQATRLTHYAFNAAPHAPYIEL 80 Query: 87 AKQL---IDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVAFKNAFHGRTL 143 ++L + + NSGAEA E ALK+ R + ++ ++AF AFHGRTL Sbjct: 81 MERLAAFVPVDYPVSGMLTNSGAEAAENALKIVRG------ATGRTAVIAFDGAFHGRTL 134 Query: 144 FTVSAGGQPA-YSQDFAPLPPQIQHAIY----NDLDSAKAL----------IDDNTCAV- 187 T++ G+ A Y Q LP + H Y N + A+AL ID N A Sbjct: 135 ATLNLNGKVAPYKQKVGVLPGPVYHLPYPSQDNGVTCAEALKAMERLFSVEIDVNDVACF 194 Query: 188 IVEPMQGEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDL 247 IVEP+QGE G + D F + LR+ CD +LI DE+Q+G GRTG+ +A+ G+ PDL Sbjct: 195 IVEPVQGEAGFLAMDVPFAQALRQFCDDKGIVLIIDEIQSGFGRTGQRFAFSRLGIEPDL 254 Query: 248 LSTAKALGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNG 307 + K++ GG P+GA++ + + G G TY GNP+ACA A AT++ N Sbjct: 255 ILLGKSIAGGVPLGAVVGRKALLDNLPKGGLGGTYSGNPIACAAA---LATLDEMTDAN- 310 Query: 308 VKQRHQWFCERLNAINARYGLFK---------EIRGLGLLIGCVLKDEYAGKAKAISNQ- 357 H W ++ AI +RY ++ + G+G + G L A A Q Sbjct: 311 ---LHAWGVQQQEAIVSRYESWRSRGLSPYLGRLTGIGAMRGIELSQADGTPASAQLTQL 367 Query: 358 ---AAEEGLMILIAG--ANVVRFAPALIISEDEVNSGLDRFELACKRFLA 402 A E GL+++ +G ++VR L + GLD E AC LA Sbjct: 368 LALARESGLLLMPSGKSRHIVRLLAPLTTEPAVLEEGLDILE-ACLAKLA 416 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 416 Length adjustment: 31 Effective length of query: 375 Effective length of database: 385 Effective search space: 144375 Effective search space used: 144375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory