GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astE in Pseudomonas fluorescens FW300-N2C3

Align Succinylglutamate desuccinylase (EC 3.5.1.96) (characterized)
to candidate AO356_18755 AO356_18755 succinylglutamate desuccinylase

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1977
         (336 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755 AO356_18755
           succinylglutamate desuccinylase
          Length = 335

 Score =  601 bits (1550), Expect = e-177
 Identities = 304/335 (90%), Positives = 319/335 (95%), Gaps = 1/335 (0%)

Query: 1   MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVRPPEARDNGLDLLLSAGIHG 60
           MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEV+PPEARDNGLDLLLSAGIHG
Sbjct: 1   MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVKPPEARDNGLDLLLSAGIHG 60

Query: 61  NETAPIELLDRLLHDIARGDLKPRARILFLFGNPEAIRKGERFVEQDVNRLFNGRHEQSS 120
           NETAPIELLDRLLHDIARGDLKPRARILFLFGNPEAIR+GERFVEQDVNRLFNGRHE S 
Sbjct: 61  NETAPIELLDRLLHDIARGDLKPRARILFLFGNPEAIRRGERFVEQDVNRLFNGRHELSG 120

Query: 121 GCEALRACELERLAASFFSLPDRQRLHYDLHTAIRGSKIEQFALYPWKEDRQHSRQELAR 180
           G EALRACELERLAASFFS P+R RLHYDLHTAIRGSKIEQFALYPWKE R HSR+ELAR
Sbjct: 121 GPEALRACELERLAASFFSRPERSRLHYDLHTAIRGSKIEQFALYPWKEGRAHSRRELAR 180

Query: 181 LRAAGMEAVLLQNKPSIVFSSYTYDKLGAEAFTLELGKARPFGQNDGVNVSLLEKRLKQI 240
           LRAAGMEAVLLQNKPSIVFS+YTYD+LGAE+FTLELGKARPFGQNDGVNV LLE RL+QI
Sbjct: 181 LRAAGMEAVLLQNKPSIVFSAYTYDQLGAESFTLELGKARPFGQNDGVNVGLLETRLQQI 240

Query: 241 IEGTEPELTEDALDGLQLYSVAREIIKHSDSFRLNLPADIENFSELEVGYLLAEDIANTR 300
           IEG EP L ++ LDGLQL+SVAREIIKHSDSFRLNLPADIENFSELE GY+LAEDIA TR
Sbjct: 241 IEGNEPAL-DEGLDGLQLFSVAREIIKHSDSFRLNLPADIENFSELEKGYVLAEDIAQTR 299

Query: 301 WIIEEEGARIIFPNPRVKNGLRAGILVVPTTDENL 335
           W+IEEEGARIIFPNP+VKNGLRAGIL+VP TDENL
Sbjct: 300 WVIEEEGARIIFPNPKVKNGLRAGILIVPATDENL 334


Lambda     K      H
   0.319    0.138    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 504
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 336
Length of database: 335
Length adjustment: 28
Effective length of query: 308
Effective length of database: 307
Effective search space:    94556
Effective search space used:    94556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate AO356_18755 AO356_18755 (succinylglutamate desuccinylase)
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03242.hmm
# target sequence database:        /tmp/gapView.6822.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03242  [M=319]
Accession:   TIGR03242
Description: arg_catab_astE: succinylglutamate desuccinylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
     2e-122  394.5   0.0   2.2e-122  394.3   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755  AO356_18755 succinylglutamate de


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755  AO356_18755 succinylglutamate desuccinylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  394.3   0.0  2.2e-122  2.2e-122       1     319 []       6     327 ..       6     327 .. 0.97

  Alignments for each domain:
  == domain 1  score: 394.3 bits;  conditional E-value: 2.2e-122
                                       TIGR03242   1 dflaltlekkep.evtqgeaknvklrwldeGvlelePe..aeaekslvisaGihGnetaPiel 60 
                                                     ++l+ltl+ +ep e+tq + ++v++rwl eG+le++P   ++   +l++saGihGnetaPiel
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755   6 KLLELTLAGREPaEKTQLTVEGVRMRWLSEGALEVKPPeaRDNGLDLLLSAGIHGNETAPIEL 68 
                                                     589******9997889999*****************9855677889***************** PP

                                       TIGR03242  61 leqllsdiaagklqlkvrlLlilGnpaalrkgkRyleedlnRlfgGryqeleeskeklRaeeL 123
                                                     l++ll+dia+g+l+ ++r+L+++Gnp a+r+g+R++e+d+nRlf+Gr+ el+ + e+lRa eL
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755  69 LDRLLHDIARGDLKPRARILFLFGNPEAIRRGERFVEQDVNRLFNGRH-ELSGGPEALRACEL 130
                                                     ************************************************.9************* PP

                                       TIGR03242 124 eqvveaffeagkasearyhyDlhtaiRasklekfallPyq.ekpfdkellewlaaadldavll 185
                                                     e  ++ ff+++++s  r+hyDlhtaiR+sk+e+fal+P + ++ +++++l++l+aa+++avll
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755 131 ERLAASFFSRPERS--RLHYDLHTAIRGSKIEQFALYPWKeGRAHSRRELARLRAAGMEAVLL 191
                                                     *************9..8**********************999********************* PP

                                       TIGR03242 186 hkekggtfshfssekleaeactlelGkarPfGendlsqfqaitealralisdeaiparkke.e 247
                                                     ++++++ fs++++++l+ae++tlelGkarPfG+nd +++  ++++l+++i +++ + ++    
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755 192 QNKPSIVFSAYTYDQLGAESFTLELGKARPFGQNDGVNVGLLETRLQQIIEGNEPALDEGLdG 254
                                                     **************************************************9998888776559 PP

                                       TIGR03242 248 lklfevvesilkksdsfelhvaedasnftefakGtllaedkde.ryrveeeeerilfPnakva 309
                                                     l+lf+v ++i+k+sdsf+l++++d++nf+e++kG++laed ++ r+++eee++ri+fPn+kv+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755 255 LQLFSVAREIIKHSDSFRLNLPADIENFSELEKGYVLAEDIAQtRWVIEEEGARIIFPNPKVK 317
                                                     ****************************************9988******************* PP

                                       TIGR03242 310 nGlRaglllv 319
                                                     nGlRag+l+v
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18755 318 NGLRAGILIV 327
                                                     *******996 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (319 nodes)
Target sequences:                          1  (335 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.92
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory