Align 4-guanidinobutyramide hydrolase; SubName: Full=Carbon-nitrogen hydrolase (characterized, see rationale)
to candidate AO356_14225 AO356_14225 carbon-nitrogen hydrolase
Query= uniprot:A0A291T0X0 (265 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_14225 Length = 264 Score = 218 bits (554), Expect = 1e-61 Identities = 120/263 (45%), Positives = 163/263 (61%), Gaps = 4/263 (1%) Query: 4 LRTALLQNSGHPGDPAGNLKVLDEAAARAAADGAGLLVTAEMFLTGYAIG-GGVRDLAEP 62 +R AL Q P DPAGNL L + A A GA +LV EMF+TGY IG V LAE Sbjct: 1 MRVALYQCPPLPLDPAGNLHRLHQVALEAR--GADVLVLPEMFMTGYNIGVDAVNVLAEV 58 Query: 63 ADGPSGRAVADIAAAHGLAILYGYPER-HAGAVHNSARLVGADGTELANYRKTHLYGCFE 121 +G + + IA A LAI+YGYPER G ++N+ +L+ A G LANYRK+HL+G + Sbjct: 59 YNGEWAQQIGRIAKAANLAIVYGYPERGEDGQIYNAVQLIDAQGERLANYRKSHLFGDLD 118 Query: 122 RASFTPGETPVVQATVGELTVGILVCYDVEFPENVRAHALAGTDLLLVPTAQMHPFEFVA 181 A F+ G++ + + +G+L+CYD+EFPEN R ALAG +L+LVPTA M P+EF+A Sbjct: 119 HAMFSAGDSALPIVELNGWKLGLLICYDLEFPENARRLALAGAELILVPTANMQPYEFIA 178 Query: 182 ESLIPVRAFESQMYIAYVNRSGPEGEFDFVGLSCLAGPDGATCLRAGRGEELLLGDVDPK 241 + + RA E+Q ++AY N G E E + G S +A P+G+ AG E L++G++D + Sbjct: 179 DVTVRARAIENQCFVAYANYCGHEAELQYCGQSSIAAPNGSRPALAGLDEALIVGELDRQ 238 Query: 242 LLTTSRRINPYLRDRRPGLYTSL 264 LL SR YL DRRP LY L Sbjct: 239 LLDDSRAAYNYLHDRRPELYDDL 261 Lambda K H 0.319 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 264 Length adjustment: 25 Effective length of query: 240 Effective length of database: 239 Effective search space: 57360 Effective search space used: 57360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory