Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate AO356_28685 AO356_28685 betaine-aldehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28685 Length = 496 Score = 392 bits (1008), Expect = e-113 Identities = 217/482 (45%), Positives = 295/482 (61%), Gaps = 8/482 (1%) Query: 20 GRAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLA 79 GR FI G + DA +G F +P LA+VA D + AV ARA F +G W+Q + Sbjct: 18 GRLFIGGTWQDAANGRRFAVENPATEHTLAEVAEGGERDVDAAVAAARAAF-TGTWAQQS 76 Query: 80 PAKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVY 139 PA+R L R A+LL ++ EELA L TL+ GKPIG + + AA I + A K+ Sbjct: 77 PAQRGLLLFRLAELLDQHREELAQLITLENGKPIGAARG-EAASAANIIRYFAGWPTKIE 135 Query: 140 DEVAPTPHDQ----LGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEK 195 P L REPVGV IVPWNFPL M WKLGP LATG VLKP+E+ Sbjct: 136 GSTLPVSPSSGAPMLNYTLREPVGVCALIVPWNFPLTMCVWKLGPVLATGCVAVLKPAEQ 195 Query: 196 SPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVY 255 +PL AIR+ QL AG PAGV+N+L G G G LA H DVD + FTGST++ + L+ Sbjct: 196 TPLVAIRLVQLIEAAGFPAGVVNLLTGLGAQTGAPLAQHPDVDKIAFTGSTQVGR-LIAQ 254 Query: 256 AGESNMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIK 315 A NMK++ LE GGKSPNI+ DA D+ AA+ AA I +NQG+VCTAGSRL V S+ Sbjct: 255 AATGNMKKVSLELGGKSPNIILPDA-DIVRAAKGAADGIFYNQGQVCTAGSRLYVHASVL 313 Query: 316 DKFLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTL 375 D+ L + G LDP +++G LV +Q+ TV Y++ G ++GA+L+ GG R Sbjct: 314 DQVLEELQRHAAAHVLGPGLDPASSMGPLVSARQLGTVRGYLQRGQEEGAELICGGDRPA 373 Query: 376 EETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWT 435 G ++ P++F +A+EEIFGPVL+V+++ +E V AND+PYGLAAG+WT Sbjct: 374 HLERGHFIRPSVFLDRAERACVAREEIFGPVLTVMSWTEIDELVLRANDSPYGLAAGLWT 433 Query: 436 SDISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATWI 495 D+ AH+ A ++AGSVW+N ++ D +PFGG+KQSG GR+ + ++ YTE K+ ++ Sbjct: 434 RDLRSAHRVAAQLKAGSVWINCWNVVDPASPFGGYKQSGWGREMGKNVIDAYTETKSVYV 493 Query: 496 KL 497 L Sbjct: 494 DL 495 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 673 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 496 Length adjustment: 34 Effective length of query: 463 Effective length of database: 462 Effective search space: 213906 Effective search space used: 213906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory