GapMind for catabolism of small carbon sources

 

Aligments for a candidate for kauB in Pseudomonas fluorescens FW300-N2C3

Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate AO356_28685 AO356_28685 betaine-aldehyde dehydrogenase

Query= metacyc::MONOMER-11560
         (497 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_28685 AO356_28685
           betaine-aldehyde dehydrogenase
          Length = 496

 Score =  392 bits (1008), Expect = e-113
 Identities = 217/482 (45%), Positives = 295/482 (61%), Gaps = 8/482 (1%)

Query: 20  GRAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLA 79
           GR FI G + DA +G  F   +P     LA+VA     D + AV  ARA F +G W+Q +
Sbjct: 18  GRLFIGGTWQDAANGRRFAVENPATEHTLAEVAEGGERDVDAAVAAARAAF-TGTWAQQS 76

Query: 80  PAKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVY 139
           PA+R   L R A+LL ++ EELA L TL+ GKPIG +   +   AA  I + A    K+ 
Sbjct: 77  PAQRGLLLFRLAELLDQHREELAQLITLENGKPIGAARG-EAASAANIIRYFAGWPTKIE 135

Query: 140 DEVAPTPHDQ----LGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEK 195
               P         L    REPVGV   IVPWNFPL M  WKLGP LATG   VLKP+E+
Sbjct: 136 GSTLPVSPSSGAPMLNYTLREPVGVCALIVPWNFPLTMCVWKLGPVLATGCVAVLKPAEQ 195

Query: 196 SPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVY 255
           +PL AIR+ QL   AG PAGV+N+L G G   G  LA H DVD + FTGST++ + L+  
Sbjct: 196 TPLVAIRLVQLIEAAGFPAGVVNLLTGLGAQTGAPLAQHPDVDKIAFTGSTQVGR-LIAQ 254

Query: 256 AGESNMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIK 315
           A   NMK++ LE GGKSPNI+  DA D+  AA+ AA  I +NQG+VCTAGSRL V  S+ 
Sbjct: 255 AATGNMKKVSLELGGKSPNIILPDA-DIVRAAKGAADGIFYNQGQVCTAGSRLYVHASVL 313

Query: 316 DKFLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTL 375
           D+ L  +         G  LDP +++G LV  +Q+ TV  Y++ G ++GA+L+ GG R  
Sbjct: 314 DQVLEELQRHAAAHVLGPGLDPASSMGPLVSARQLGTVRGYLQRGQEEGAELICGGDRPA 373

Query: 376 EETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWT 435
               G ++ P++F        +A+EEIFGPVL+V+++   +E V  AND+PYGLAAG+WT
Sbjct: 374 HLERGHFIRPSVFLDRAERACVAREEIFGPVLTVMSWTEIDELVLRANDSPYGLAAGLWT 433

Query: 436 SDISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATWI 495
            D+  AH+ A  ++AGSVW+N ++  D  +PFGG+KQSG GR+   + ++ YTE K+ ++
Sbjct: 434 RDLRSAHRVAAQLKAGSVWINCWNVVDPASPFGGYKQSGWGREMGKNVIDAYTETKSVYV 493

Query: 496 KL 497
            L
Sbjct: 494 DL 495


Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 673
Number of extensions: 35
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 496
Length adjustment: 34
Effective length of query: 463
Effective length of database: 462
Effective search space:   213906
Effective search space used:   213906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory