GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patD in Pseudomonas fluorescens FW300-N2C3

Align 4-trimethylammoniobutyraldehyde dehydrogenase (EC 1.2.1.47) (characterized)
to candidate AO356_13795 AO356_13795 betaine-aldehyde dehydrogenase

Query= BRENDA::P49189
         (494 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13795 AO356_13795
           betaine-aldehyde dehydrogenase
          Length = 490

 Score =  472 bits (1215), Expect = e-137
 Identities = 244/477 (51%), Positives = 328/477 (68%), Gaps = 7/477 (1%)

Query: 23  ADASG--TEKAFEPATGRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEA 80
           +DASG  T +A  PA G V+A    +  ++V  AV +A+   K+W+  + M+R RIL  A
Sbjct: 16  SDASGDATFEAINPANGEVLALVQRATFEDVERAVVSAEKGQKVWAAMTAMQRSRILRRA 75

Query: 81  ARIIREREDEIATMECINNGKSIFEAR-LDIDISWQCLEYYAGLAASMAGEHIQLPGGSF 139
             I+RER DE+A +E ++ GK+  E R +DI      LEYYAGL  ++ GE I L   SF
Sbjct: 76  VDILRERNDELAALETLDTGKAYSETRYVDIVTGADVLEYYAGLVPAIEGEQIPLRDTSF 135

Query: 140 GYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEA 199
            YTRREPLGV  GIGAWNYP QIA WKSAPALA GNAM+FKPS  T ++ L LAEIY+EA
Sbjct: 136 VYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEA 195

Query: 200 GVPPGLFNVVQG-GAATGQFLCQHPDVAKVSFTGSVPTGMKIM-EMSAKGIKPVTLELGG 257
           GVP G+FNV+ G G   G +L +HP + KVSFTG   TG K+M   S+  +K VT+ELGG
Sbjct: 196 GVPAGVFNVLTGSGREVGTWLTEHPRIEKVSFTGGTDTGKKVMASASSSSLKEVTMELGG 255

Query: 258 KSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKI 317
           KSPLII  D D++ A   A+MANF + GQVC NGTRVFV   +   F  ++ ++  RI++
Sbjct: 256 KSPLIICDDADLDRAADTAMMANFYSSGQVCTNGTRVFVPSHLKAAFEAKIAERVARIRV 315

Query: 318 GDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCV 377
           G+P  E+T  GPL++  H+E VLG+++  K +GA++LCGG      + +   G ++ P V
Sbjct: 316 GNPEDENTNFGPLVSFAHMESVLGYIEKGKAEGARLLCGGGRLT--EGEFAKGAFVAPTV 373

Query: 378 LTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAE 437
            T+C D+MT V+EEIFGPVMSIL++DTE EV+ RANDT FGLAAGV TRD+ RAHR++ +
Sbjct: 374 FTDCTDEMTIVREEIFGPVMSILTYDTEEEVIRRANDTDFGLAAGVVTRDLNRAHRIIHQ 433

Query: 438 LQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF 494
           L+AG C+IN +  S  ++P GGYK+SG GRENG  ++  ++++K+V VE+GD  S F
Sbjct: 434 LEAGICWINAWGESDAKMPVGGYKQSGVGRENGISSLNNFTRIKSVQVELGDYASVF 490


Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 698
Number of extensions: 31
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 494
Length of database: 490
Length adjustment: 34
Effective length of query: 460
Effective length of database: 456
Effective search space:   209760
Effective search space used:   209760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory