GapMind for catabolism of small carbon sources

 

Aligments for a candidate for speB in Pseudomonas fluorescens FW300-N2C3

Align agmatinase (EC 3.5.3.11) (characterized)
to candidate AO356_04095 AO356_04095 agmatinase

Query= BRENDA::W5PHZ9
         (361 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095 AO356_04095
           agmatinase
          Length = 316

 Score =  413 bits (1061), Expect = e-120
 Identities = 201/308 (65%), Positives = 238/308 (77%)

Query: 51  NQPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIREES 110
           +QP     + R  GI +MMRLP   T  GLDAA VGVPLDIGTS R G RFGPR IR ES
Sbjct: 6   HQPLGGNEMPRFGGIATMMRLPHLQTAAGLDAAFVGVPLDIGTSLRAGTRFGPREIRAES 65

Query: 111 VMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGD 170
           VM+R  N +TGA PF  L VAD+GDV +N +NL D+ R+I   Y KI+    +PLTLGGD
Sbjct: 66  VMIRPYNMATGAAPFDSLSVADIGDVPINTFNLLDAVRIIEESYHKILEHNVIPLTLGGD 125

Query: 171 HTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKRVVQ 230
           HTIT PIL+AI +KHG VGLVH+DAH D  D   GEK+ HGT FRR V+EGLLDC RVVQ
Sbjct: 126 HTITLPILRAIHKKHGKVGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDCDRVVQ 185

Query: 231 IGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLD 290
           IG+R    T D + +SR+QGFRVV AE+CW KSL PLM EVR+++GG P+Y+SFDIDG+D
Sbjct: 186 IGLRAQGYTADDFNWSRNQGFRVVQAEECWHKSLAPLMAEVREKVGGGPVYLSFDIDGID 245

Query: 291 PAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFE 350
           PA+APGTGTPEI GLT  QA+EI+RGCQGL++VGCDLVEVSPPYD +GNT+L+ ANLL+E
Sbjct: 246 PAWAPGTGTPEIGGLTTIQAIEIVRGCQGLDLVGCDLVEVSPPYDTTGNTSLLGANLLYE 305

Query: 351 MLCVLPKV 358
           MLCVLP V
Sbjct: 306 MLCVLPGV 313


Lambda     K      H
   0.321    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 430
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 316
Length adjustment: 28
Effective length of query: 333
Effective length of database: 288
Effective search space:    95904
Effective search space used:    95904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate AO356_04095 AO356_04095 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01230.hmm
# target sequence database:        /tmp/gapView.25818.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01230  [M=275]
Accession:   TIGR01230
Description: agmatinase: agmatinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
    4.6e-67  212.5   0.0    5.6e-67  212.2   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095  AO356_04095 agmatinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095  AO356_04095 agmatinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.2   0.0   5.6e-67   5.6e-67      14     274 ..      36     308 ..      24     309 .. 0.94

  Alignments for each domain:
  == domain 1  score: 212.2 bits;  conditional E-value: 5.6e-67
                                       TIGR01230  14 evvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGda 75 
                                                     ++  vg+P+d  ts r+G+r+gp  ir  s+ +  y+   +   ++ l v+D gd+p+ + + 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095  36 DAAFVGVPLDIGTSLRAGTRFGPREIRAESVMIRPYNMATGaAPFDSLSVADIGDVPINTFNL 98 
                                                     56678********************************9998678******************9 PP

                                       TIGR01230  76 remvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefege 138
                                                      + v  iee  +++le++  ++++GG+H+itlp++rA++kk++k+ +v++DAH+D+ d+  ge
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095  99 LDAVRIIEESYHKILEHNVIPLTLGGDHTITLPILRAIHKKHGKVGLVHIDAHADVNDHMFGE 161
                                                     *************************************************************** PP

                                       TIGR01230 139 klshacvmrrvlelg....lnvlqigiRsg..ikeeadlarennikvlk.relede.....ia 189
                                                     k+ h ++ rr++e g     +v+qig+R++  + +++++ r+++ +v++  e  ++     +a
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095 162 KIAHGTTFRRAVEEGlldcDRVVQIGLRAQgyTADDFNWSRNQGFRVVQaEECWHKslaplMA 224
                                                     *************99777779*******97446899**********99866665556677799 PP

                                       TIGR01230 190 evlakvldkpvyvtiDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEva 252
                                                     ev  kv + pvy+++DiD++DPa+aPG+gtpe+gGlt+ ++++  v++ +   +vG+D+vEv+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095 225 EVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAIE-IVRGCQGLDLVGCDLVEVS 286
                                                     999****************************************.99***************** PP

                                       TIGR01230 253 Pvydssevtaltaaklalelll 274
                                                     P yd++  t l+ a+l +e+l 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_04095 287 PPYDTTGNTSLLGANLLYEMLC 308
                                                     ********************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (275 nodes)
Target sequences:                          1  (316 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.82
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory