Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate AO356_28625 AO356_28625 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28625 Length = 259 Score = 247 bits (631), Expect = 2e-70 Identities = 131/255 (51%), Positives = 174/255 (68%), Gaps = 11/255 (4%) Query: 18 SDEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSG 77 S+E+ I+ ++K +G+ +L+ I+L V RGE +V+ G SGSGK+T IRCIN LE+ Q G Sbjct: 5 SEELIIEALDVHKSFGELQILKGISLQVRRGEVVVLIGASGSGKTTFIRCINLLEDIQGG 64 Query: 78 KIIV-----------DGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWV 126 +I V DG + +NI + R ++GMVFQ FNLFPH+T LEN+ API V Sbjct: 65 RIRVNGRAMGYRERADGSLVRESERNIARQRRDIGMVFQRFNLFPHMTALENIIEAPIQV 124 Query: 127 RKVPKREAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTS 186 V + A E A LE+V + ++A YP LSGGQQQRVAIAR+L MKP+ MLFDEPTS Sbjct: 125 LGVSRVAALEQARGLLERVGLADKADHYPSMLSGGQQQRVAIARALAMKPQAMLFDEPTS 184 Query: 187 ALDPEMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFH 246 ALDPE + EVL M +LAEEGMTM+ VTHEMGFA+ VA+RV+ + G+++EQ P F Sbjct: 185 ALDPETVGEVLQVMKELAEEGMTMVVVTHEMGFAREVADRVVVLDQGELIEQGPPEQIFC 244 Query: 247 NPQSERTKQFLSQIL 261 +P RT+ FLS++L Sbjct: 245 HPIHPRTRAFLSRVL 259 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 259 Length adjustment: 25 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory