Align Citrate:H+ symporter (characterized)
to candidate AO356_30335 AO356_30335 MFS transporter
Query= TCDB::P16482 (444 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_30335 Length = 456 Score = 221 bits (563), Expect = 4e-62 Identities = 140/414 (33%), Positives = 222/414 (53%), Gaps = 7/414 (1%) Query: 36 GNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFAVFGAGFLMRPIGAIVLGAYIDK 95 GNF E +DF +FGF ++ FFP S A+L+ TFAV+ F+ RP+G ++ G D+ Sbjct: 19 GNFGEIYDFAVFGFSIPILSVHFFPGSDRTAALLSTFAVYAVAFVARPLGGLMFGYLADR 78 Query: 96 VGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIGRLLQGFSAGAELGGVSVYL 155 +GR + + +T+ +MA GT +I L+P+Y TIG+ APLL+L+ R+ QG + G E G + Y+ Sbjct: 79 LGRIRVMAMTVWLMALGTAIIGLLPTYATIGIAAPLLLLLCRIAQGLALGGETTGSTSYI 138 Query: 156 AEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFALNAVLEPSAISDWGWRIPFLFGVLIVP 215 E A R+G++ + + V A + AL A SDW WRIPFL G +I Sbjct: 139 VESAPENRRGYWLGFTLIFSHLPNAVVAGLVVALQLGAGDQAYSDWAWRIPFLLGGIIGV 198 Query: 216 FIFILRRKLEETQEF-TARRHHLAMRQVFATLLANWQV-VIAGMMMVAMTTTAF----YL 269 F LRR ++E +E+ AR+ A + L+A + + GM+ V M F YL Sbjct: 199 VGFWLRRNIDEPEEYKQARQASKASKIKKNPLIAAIRCGGLRGMLHVFMVQPVFSVGAYL 258 Query: 270 ITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDRFGRRSVLIAMTLLALA 329 + + TF +V L ++ +L+ + I LP+GG LSDRFGR+ VL Sbjct: 259 LLGFMYTFLIEVGKLDSTSALISNAIAVIVLSALLPLGGLLSDRFGRKRVLTFGAAWIAL 318 Query: 330 TAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMIPALTEIMPAEVRVAGFSLAYSLA 389 +A+PA+ LA + SF ++ L+ G+Y A A E P R G +++Y + Sbjct: 319 SAYPAM-YLAASGSFASAVAGQTLLAAGLGIYGAASFVAAAEFFPTSFRATGHAISYQTS 377 Query: 390 TAVFGGFTPVISTALIEYTGDKASPGYWMSFAAICGLLATCYLYRRSAVALQTA 443 A+FGG P+I+ L + G +P ++++ A+ L+ T ++ V L+T+ Sbjct: 378 VAMFGGTCPLIAAYLSQAFGSPLAPAFYVTLIAVLCLITTQFVPETRGVNLRTS 431 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 572 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 456 Length adjustment: 33 Effective length of query: 411 Effective length of database: 423 Effective search space: 173853 Effective search space used: 173853 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory