Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate AO356_16420 AO356_16420 histidinol phosphatase
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_16420 Length = 263 Score = 162 bits (411), Expect = 5e-45 Identities = 94/240 (39%), Positives = 136/240 (56%), Gaps = 4/240 (1%) Query: 16 KVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLA 75 ++L+D+ L + G+ L+GPNG GKSTLL + + P G + L + P+ L+ R +A Sbjct: 26 ELLHDIHLDIRRGETLGLVGPNGSGKSTLLKLLAGVRAPSRGDIRLNNQPLKTLARRTVA 85 Query: 76 RRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRR 135 + L+++ Q T + I+V + V+ GR PWLS S ED A V A+ HL R Sbjct: 86 QTLAVVEQQADTLDAISVFDAVALGRTPWLSALSPWSNEDAAIVQQALWDVDAAHLKNRT 145 Query: 136 LTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVL 195 LSGG+RQR +A LAQ ++LLDEPT +LDI HQ+ +++++ L T V L Sbjct: 146 WHSLSGGERQRVHIARALAQRPQILLLDEPTNHLDIQHQLAILKVVQALPV---TTVIAL 202 Query: 196 HDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIHPEPVSGRPMCLMR 255 HDLNQA CD+L V+ G ++A G P EV+TP L+ F V A +P G + R Sbjct: 203 HDLNQALT-CDRLAVLERGRLVALGKPLEVLTPQRLQDTFGVHAHYLIDPFDGAQILRFR 261 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 263 Length adjustment: 24 Effective length of query: 231 Effective length of database: 239 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory