Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate AO356_00600 AO356_00600 pyrroline-5-carboxylate reductase
Query= curated2:P74572 (267 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_00600 Length = 261 Score = 108 bits (269), Expect = 2e-28 Identities = 79/254 (31%), Positives = 129/254 (50%), Gaps = 11/254 (4%) Query: 5 LGIIGG-GVMAEAILARLIAEKTYAPEEIIVGEPHGARRDYLQKTYQVRVSPDNQEAANV 63 LGIIGG G + AI ++A++ +I+ G Q V DNQ+ N Sbjct: 6 LGIIGGTGWLGGAIAKAVLAKELVPAGNLIISNRSGNHPLAQQGACLVT---DNQDLVNR 62 Query: 64 SEVLLLAVKPQVLDRVLASLAGGANRPLVISILAGVSLQRIQKGFPDHAIIRAMPNTPAT 123 S V+++AV+P+ ASL A VIS++AG++ Q I A++RAMPN Sbjct: 63 SAVVIIAVRPEHF----ASLGINATGKTVISLMAGITAQAIAAQTSASAVVRAMPNAAVE 118 Query: 124 VGAGMTAIAANKMVEPDQLAKAKAIFSAVGNVVEVP-ENLMDAVTGVSGSGPAYVALMIE 182 +G T + P + + +F VG EV E+ +D ++ +SG+GPA+ AL++ Sbjct: 119 IGQSFTPWYGFSAIAPATKSLVQQLFECVGTAAEVEKEDFIDYLSALSGTGPAFPALLMT 178 Query: 183 ALADGGVLAGLPRAIAQKLALQTVLGTAELIKETEEHPAQIKDKVTSPGGTTIAGVAVLE 242 ALA +LAG+P IAQ A V+ +++L+ + Q+ D + + G T A + V+ Sbjct: 179 ALAHQAMLAGIPGDIAQLAAKSVVVDSSQLLASRDAQ--QMIDALVAYRGVTAAALQVMS 236 Query: 243 KMGFRSAIIEAVRA 256 + F + A++A Sbjct: 237 RGDFEVQLGRALQA 250 Lambda K H 0.316 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 261 Length adjustment: 25 Effective length of query: 242 Effective length of database: 236 Effective search space: 57112 Effective search space used: 57112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory