GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Pseudomonas fluorescens FW300-N2C3

Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate AO356_26715 AO356_26715 4-aminobutyrate aminotransferase

Query= BRENDA::Q0K2K2
         (423 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715 AO356_26715
           4-aminobutyrate aminotransferase
          Length = 430

 Score =  434 bits (1117), Expect = e-126
 Identities = 220/415 (53%), Positives = 285/415 (68%), Gaps = 1/415 (0%)

Query: 8   LNQRRTLATPRGVGVMCDFYADRAENATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAI 67
           L ++R    PRG+        DRA+ A +WDV+G  Y DF  GI VLN GH HP+V+ A+
Sbjct: 11  LLRQRDQFVPRGLVTAHPLVIDRAQGAEVWDVDGARYLDFVGGIGVLNIGHNHPKVVAAV 70

Query: 68  AAQLERFTHTAYQIVPYQGYVTLAERINALVPIQGLNKTALFTTGAEAVENAIKIARAHT 127
            AQL++ +H  +Q+V Y+ Y+ L +R+  LV  Q   K ALFT+GAEAVENA+KIARAHT
Sbjct: 71  QAQLQKVSHACFQVVAYKPYLDLVKRLCELVGGQQAYKAALFTSGAEAVENAVKIARAHT 130

Query: 128 GRPGVIAFSGAFHGRTLLGMALTGKVAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQA 187
            RP VI+F G FHGRTLLG  LTG   PYK  FGPF  +++H P+P+A  G S+E ALQA
Sbjct: 131 NRPAVISFRGGFHGRTLLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYRGFSSEMALQA 190

Query: 188 LEGLFKTDIDPARVAAIIVEPVQGEGGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFG 247
           L  L  T + P RVAAII+EPVQG+GGF +AP +F++ LR + +QHGIVLI DE+QTGFG
Sbjct: 191 LNELLATQVAPDRVAAIIIEPVQGDGGFLSAPPEFLQALRTLTEQHGIVLILDEIQTGFG 250

Query: 248 RTGKMFAMSHHDVEPDLITMAKSLAGGMPLSAVSGRAAIMDAPLPGGLGGTYAGNPLAVA 307
           RTGK F   H  ++PDL+T+AKSLAGG+P+S V GRA IMDAPLPGGLGGTY GN L+ A
Sbjct: 251 RTGKWFGFQHAGIQPDLVTVAKSLAGGLPISGVVGRAHIMDAPLPGGLGGTYGGNALSCA 310

Query: 308 AAHAVIDVIEEEKLCERSASLGQQLREHLLAQRKHCPAMAEVRGLGSMVAAEFC-DPATG 366
           AA AVID  E+E+L ER   LG++LR+ LL  +   P + +VRG G M+A E   D    
Sbjct: 311 AALAVIDAYEQEQLLERGQVLGERLRQGLLRLQARHPRIGDVRGTGFMLAIELIKDDEAR 370

Query: 367 QPSAEHAKRVQTRALEAGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLTQAL 421
            P AE  +++  +A    L+++ CG + NV+RFL PL   ++Q D AL +L  AL
Sbjct: 371 SPDAELTQQLIDQARVGRLLVIKCGVHRNVLRFLAPLVTEESQIDEALTILEAAL 425


Lambda     K      H
   0.321    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 529
Number of extensions: 21
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 423
Length of database: 430
Length adjustment: 32
Effective length of query: 391
Effective length of database: 398
Effective search space:   155618
Effective search space used:   155618
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)

Align candidate AO356_26715 AO356_26715 (4-aminobutyrate aminotransferase)
to HMM TIGR00700 (gabT: 4-aminobutyrate transaminase (EC 2.6.1.19))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00700.hmm
# target sequence database:        /tmp/gapView.17617.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00700  [M=420]
Accession:   TIGR00700
Description: GABAtrnsam: 4-aminobutyrate transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   2.8e-162  526.0   0.0   3.2e-162  525.8   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715  AO356_26715 4-aminobutyrate amin


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715  AO356_26715 4-aminobutyrate aminotransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  525.8   0.0  3.2e-162  3.2e-162       2     418 ..      14     425 ..      13     427 .. 0.99

  Alignments for each domain:
  == domain 1  score: 525.8 bits;  conditional E-value: 3.2e-162
                                       TIGR00700   2 rraaavskGvgvtlrvlaakaegaelkdvdGnrlidlaagiavlnvGhshPkvveavkrqvee 64 
                                                     +r+++v++G+ ++ + ++ +a+gae+ dvdG r++d+ +gi+vln+Gh+hPkvv+av+ q+++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715  14 QRDQFVPRGLVTAHPLVIDRAQGAEVWDVDGARYLDFVGGIGVLNIGHNHPKVVAAVQAQLQK 76 
                                                     79************************************************************* PP

                                       TIGR00700  65 lthtafqvvpyesyvelaeklnaiaPgsgekkavllnsGaeavenavkiarkytgrpgvvafs 127
                                                     + h++fqvv y+ y++l ++l+++  g +  ka+l++sGaeavenavkiar++t+rp+v++f 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715  77 VSHACFQVVAYKPYLDLVKRLCELVGGQQAYKAALFTSGAEAVENAVKIARAHTNRPAVISFR 139
                                                     *************************************************************** PP

                                       TIGR00700 128 rgfhGrtnltmaltakvkPykiGfGPfapevyraPlpydyrdialdkqeslddelaaiealfv 190
                                                     +gfhGrt l  +lt+ ++Pyk  fGPfapev+++P+p  yr+ ++      +  l+a+++l  
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715 140 GGFHGRTLLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYRGFSS------EMALQALNELLA 196
                                                     *****************************************9988......34578******* PP

                                       TIGR00700 191 adveaeqvaavvlePvqGeGGfivpakelvaavaslckehgivliadevqtGfartGklfaie 253
                                                     ++v++++vaa+++ePvqG+GGf  ++ e+++a+++l ++hgivli de+qtGf rtGk f  +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715 197 TQVAPDRVAAIIIEPVQGDGGFLSAPPEFLQALRTLTEQHGIVLILDEIQTGFGRTGKWFGFQ 259
                                                     *************************************************************** PP

                                       TIGR00700 254 heddkPdlitvaksladGlPlsgvvGraeildapapGglGGtyaGnPlavaaalavldiieee 316
                                                     h + +Pdl+tvaksla+GlP+sgvvGra+i+dap pGglGGty+Gn l++aaalav+d  e+e
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715 260 HAGIQPDLVTVAKSLAGGLPISGVVGRAHIMDAPLPGGLGGTYGGNALSCAAALAVIDAYEQE 322
                                                     *************************************************************** PP

                                       TIGR00700 317 glieraeqigklvkdklielkeevpaigdvrglGamiavelv.dpdttePdaalaekiaaaal 378
                                                      l er + +g+++++ l+ l++  p+igdvrg G m+a+el+ d +++ Pda l++++  +a+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715 323 QLLERGQVLGERLRQGLLRLQARHPRIGDVRGTGFMLAIELIkDDEARSPDAELTQQLIDQAR 385
                                                     ****************************************9978999**************** PP

                                       TIGR00700 379 aaGlllltaGifGniirlltPltisdelldeglkileaal 418
                                                        ll++ +G++ n++r+l+Pl+  ++++de+l ileaal
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26715 386 VGRLLVIKCGVHRNVLRFLAPLVTEESQIDEALTILEAAL 425
                                                     *************************************998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (420 nodes)
Target sequences:                          1  (430 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.32
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory