GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocA in Pseudomonas fluorescens FW300-N2C3

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88); Proline dehydrogenase (EC 1.5.5.2) (characterized)
to candidate AO356_09015 AO356_09015 transcriptional regulator

Query= reanno::pseudo3_N2E3:AO353_12810
         (1317 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015 AO356_09015
            transcriptional regulator
          Length = 1317

 Score = 2458 bits (6370), Expect = 0.0
 Identities = 1248/1317 (94%), Positives = 1278/1317 (97%)

Query: 1    MATTTLGVKLDDPTRERLKAAATSIDRTPHWLIKQAIFNYLEKLEGGATLTELSGLTRSE 60
            MATTTLGVKLDDPTRERLKAAATSIDRTPHWLIKQAIFNYLEKLEGGATLTEL+G  R++
Sbjct: 1    MATTTLGVKLDDPTRERLKAAATSIDRTPHWLIKQAIFNYLEKLEGGATLTELNGSPRAD 60

Query: 61   ADEGAEVHVDHAHQCFLEFAESILPQSVLRASITAAYRRPEPEVVPMLIEQARLPAPMAE 120
            +D+  +V VDHAHQCFLEFAESILPQSVLRASITAAYRRPEPEVVPMLIEQARLP  MAE
Sbjct: 61   SDDAGDVQVDHAHQCFLEFAESILPQSVLRASITAAYRRPEPEVVPMLIEQARLPLEMAE 120

Query: 121  ATNKLAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD 180
            ATNKLAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD
Sbjct: 121  ATNKLAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD 180

Query: 181  ALIRDKISTGNWQPHLGNSPSLFVNAATWGLLLTGKLVATHNEAGLTSSLSRIIGKSGEP 240
            ALIRDKISTGNWQPHLGNSPSLFVNAATWGLLLTGKLVATHNE GLTSSLSRIIGKSGEP
Sbjct: 181  ALIRDKISTGNWQPHLGNSPSLFVNAATWGLLLTGKLVATHNETGLTSSLSRIIGKSGEP 240

Query: 241  MIRKGVDMAMRLMGEQFVTGETIAEALANASKFEAKGFRYSYDMLGEAALTEHDAQKYLA 300
            MIRKGVDMAMRLMGEQFVTGETIAEALANASKFEAKGFRYSYDMLGEAALTEHDAQKYLA
Sbjct: 241  MIRKGVDMAMRLMGEQFVTGETIAEALANASKFEAKGFRYSYDMLGEAALTEHDAQKYLA 300

Query: 301  SYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPRLLSLTLLAKQ 360
            SYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPRLLSLTLLAKQ
Sbjct: 301  SYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPRLLSLTLLAKQ 360

Query: 361  YDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGFVIQAYQKRCPYVIDYVIDLAR 420
            YDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGFVIQAYQKRCPYVIDYVIDLAR
Sbjct: 361  YDIGLNIDAEEADRLELSLDLLERLCFEPQLTGWNGIGFVIQAYQKRCPYVIDYVIDLAR 420

Query: 421  RSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYIACARKLLSVPEVIYP 480
            RSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYIACARKLLSVPEVIYP
Sbjct: 421  RSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYIACARKLLSVPEVIYP 480

Query: 481  QFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAP 540
            QFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAP
Sbjct: 481  QFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAP 540

Query: 541  VGTHETLLAYLVRRLLENGANTSFVNRIADQSISIQELVADPVSSIEQMATLEGGFGLPH 600
            VGTHETLLAYLVRRLLENGANTSFVNRIADQSISIQELVADPV+SIEQMATLEGGFGLPH
Sbjct: 541  VGTHETLLAYLVRRLLENGANTSFVNRIADQSISIQELVADPVASIEQMATLEGGFGLPH 600

Query: 601  PRIPLPRDLYGSERANSSGIDLANEHRLASLSCALLATAHNNWKAAPMLGCAASAETPVP 660
            PRIPLPRDLYGS+RANSSGIDLANEHRLASLSCALLATAHN+WKAAPMLGCAAS ETP  
Sbjct: 601  PRIPLPRDLYGSDRANSSGIDLANEHRLASLSCALLATAHNDWKAAPMLGCAASEETPAA 660

Query: 661  VLNPSDLRDVVGHVQEATVTDADNAIQCALNAAPIWQATPPAERAAILERAADLMESEIQ 720
            VLNPSD RDVVGHVQEATV D DNAIQCALNAAPIWQATPPAERAAILERAADLME EIQ
Sbjct: 661  VLNPSDHRDVVGHVQEATVADVDNAIQCALNAAPIWQATPPAERAAILERAADLMEGEIQ 720

Query: 721  PLMGLLAREAGKTFANAIAEVREAVDFLRYYAVQARNDFTNDAHRPLGPVVCISPWNFPL 780
            PLMGLLAREAGKTFANAIAEVREAVDFLRYYAVQARNDFTNDAHRPLGPVVCISPWNFPL
Sbjct: 721  PLMGLLAREAGKTFANAIAEVREAVDFLRYYAVQARNDFTNDAHRPLGPVVCISPWNFPL 780

Query: 781  AIFSGQVAAALAAGNPVLAKPAEQTPLVAAQAVRILLEAGIPEGVLQLLPGRGETVGARL 840
            AIFSGQVAAALAAGNPVLAKPAEQTPLVAAQAVR++LEAGIPEGVLQLLPGRGETVGARL
Sbjct: 781  AIFSGQVAAALAAGNPVLAKPAEQTPLVAAQAVRLMLEAGIPEGVLQLLPGRGETVGARL 840

Query: 841  VGDDRVKGVMFTGSTEVARLLQRNVAGRLDAQGRPIPLIAETGGQNAMIVDSSALTEQVV 900
            VGDDRVKGVMFTGSTEVARLLQRN+AGRLD QGRPIPLIAETGGQNAMIVDSSALTEQVV
Sbjct: 841  VGDDRVKGVMFTGSTEVARLLQRNIAGRLDNQGRPIPLIAETGGQNAMIVDSSALTEQVV 900

Query: 901  IDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAECRLGNPERLSVDIGPVIDA 960
            IDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAE RLGNPERLSVDIGPVIDA
Sbjct: 901  IDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAEARLGNPERLSVDIGPVIDA 960

Query: 961  EAKAGIEKHIQAMRDKGRNVYQVAIADMEECKRGTFVMPTLIELESFDELQREIFGPVLH 1020
            EAKAGIEKHIQAMRDKGR+VYQ+AIAD +ECKRGTFVMPTLIELESFDELQREIFGPVLH
Sbjct: 961  EAKAGIEKHIQAMRDKGRSVYQMAIADSDECKRGTFVMPTLIELESFDELQREIFGPVLH 1020

Query: 1021 VVRYKRKDIDQLIGQINASGYGLTLGVHTRIDETIAKVIDNVNAGNVYVNRNIVGAVVGV 1080
            VVRYKRK++ QLI QINASGYGLTLGVHTRIDETIAKVIDNV+AGNVYVNRNIVGAVVGV
Sbjct: 1021 VVRYKRKELGQLIDQINASGYGLTLGVHTRIDETIAKVIDNVHAGNVYVNRNIVGAVVGV 1080

Query: 1081 QPFGGEGLSGTGPKAGGPLYLYRLLSTRPTDAIEQSFARGDTLSAPDVRLRDAMSKPLTA 1140
            QPFGGEGLSGTGPKAGGPLYLYRLLSTRPTDAI+QSF RGD L APD+RLRDAMSKPLTA
Sbjct: 1081 QPFGGEGLSGTGPKAGGPLYLYRLLSTRPTDAIQQSFVRGDALVAPDLRLRDAMSKPLTA 1140

Query: 1141 LKTWADSHKLTELSALCAQFATQSQSGITRTLNGPTGERNSYAILPREHVLCLAEVESDL 1200
            L+ WADS KL ELSALC QFA QSQSGITR L GPTGERNSYAILPREHVLCLA+VE DL
Sbjct: 1141 LQAWADSQKLAELSALCVQFAAQSQSGITRQLTGPTGERNSYAILPREHVLCLADVEGDL 1200

Query: 1201 LSQLAAVLAVGGSAVWPEGELSKALLARLPKDVQARIKLVADWNKDEVVFDAVLHHGHSD 1260
            L+QLAAVLAVGGSAVWPE + SKAL ARLPK++QARI+ VADW KD+V+FDAVLHHG SD
Sbjct: 1201 LTQLAAVLAVGGSAVWPETDTSKALFARLPKEIQARIQRVADWTKDDVLFDAVLHHGDSD 1260

Query: 1261 QLRAVCQQVAKRAGAIIGVQGLSQGETNIALERLVIERALSVNTAAAGGNASLMTIG 1317
            QLR VCQQVAKRAGAI+GV GLSQGETNIALERLVIERALSVNTAAAGGNASLMTIG
Sbjct: 1261 QLRDVCQQVAKRAGAIVGVHGLSQGETNIALERLVIERALSVNTAAAGGNASLMTIG 1317


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 4491
Number of extensions: 151
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 1317
Length of database: 1317
Length adjustment: 48
Effective length of query: 1269
Effective length of database: 1269
Effective search space:  1610361
Effective search space used:  1610361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)

Align candidate AO356_09015 AO356_09015 (transcriptional regulator)
to HMM TIGR01238 (delta-1-pyrroline-5-carboxylate dehydrogenase (EC 1.2.1.88))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01238.hmm
# target sequence database:        /tmp/gapView.20477.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01238  [M=500]
Accession:   TIGR01238
Description: D1pyr5carbox3: delta-1-pyrroline-5-carboxylate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
     2e-249  814.1   0.8   2.8e-249  813.6   0.8    1.2  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  AO356_09015 transcriptional regu


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  AO356_09015 transcriptional regulator
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  813.6   0.8  2.8e-249  2.8e-249       1     499 [.     608    1108 ..     608    1109 .. 0.99

  Alignments for each domain:
  == domain 1  score: 813.6 bits;  conditional E-value: 2.8e-249
                                       TIGR01238    1 dlygegrknslGvdlaneselksleeqllkaaakkfqaapivgekakaegeaqpvknpadr 61  
                                                      dlyg+ r ns G+dlane++l+sl+  ll++a+++++aap++g  a +e+    v np d+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  608 DLYGSDRANSSGIDLANEHRLASLSCALLATAHNDWKAAPMLGC-AASEETPAAVLNPSDH 667 
                                                      89****************************************55.5555666789****** PP

                                       TIGR01238   62 kdivGqvseadaaevqeavdsavaafaewsatdakeraailerladlleshmpelvallvr 122 
                                                      +d+vG+v+ea  a+v++a+++a++a+++w+at+++eraailer+adl+e ++  l++ll r
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  668 RDVVGHVQEATVADVDNAIQCALNAAPIWQATPPAERAAILERAADLMEGEIQPLMGLLAR 728 
                                                      ************************************************************* PP

                                       TIGR01238  123 eaGktlsnaiaevreavdflryyakqvedvldeesakalGavvcispwnfplaiftGqiaa 183 
                                                      eaGkt+ naiaevreavdflryya q+++++ ++++++lG+vvcispwnfplaif Gq+aa
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  729 EAGKTFANAIAEVREAVDFLRYYAVQARNDFTNDAHRPLGPVVCISPWNFPLAIFSGQVAA 789 
                                                      ************************************************************* PP

                                       TIGR01238  184 alaaGntviakpaeqtsliaaravellqeaGvpagviqllpGrGedvGaaltsderiaGvi 244 
                                                      alaaGn v+akpaeqt+l+aa+av l++eaG+p gv+qllpGrGe+vGa l  d+r++Gv+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  790 ALAAGNPVLAKPAEQTPLVAAQAVRLMLEAGIPEGVLQLLPGRGETVGARLVGDDRVKGVM 850 
                                                      ************************************************************* PP

                                       TIGR01238  245 ftGstevarlinkalakredap...vpliaetGGqnamivdstalaeqvvadvlasafdsa 302 
                                                      ftGstevarl+++++a r d++   +pliaetGGqnamivds+al+eqvv+dv++safdsa
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  851 FTGSTEVARLLQRNIAGRLDNQgrpIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSA 911 
                                                      *********************9999************************************ PP

                                       TIGR01238  303 GqrcsalrvlcvqedvadrvltlikGamdelkvgkpirlttdvGpvidaeakqnllahiek 363 
                                                      Gqrcsalrvlc+qed adrv++++kGam e ++g+p+rl  d+Gpvidaeak  +++hi++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  912 GQRCSALRVLCLQEDSADRVIEMLKGAMAEARLGNPERLSVDIGPVIDAEAKAGIEKHIQA 972 
                                                      ************************************************************* PP

                                       TIGR01238  364 mkakakkvaqvkleddvesekgtfvaptlfelddldelkkevfGpvlhvvrykadeldkvv 424 
                                                      m++k+++v+q+  +d+ e+++gtfv ptl+el+++del++e+fGpvlhvvryk++el +++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015  973 MRDKGRSVYQMAIADSDECKRGTFVMPTLIELESFDELQREIFGPVLHVVRYKRKELGQLI 1033
                                                      ************************************************************* PP

                                       TIGR01238  425 dkinakGygltlGvhsrieetvrqiekrakvGnvyvnrnlvGavvGvqpfGGeGlsGtGpk 485 
                                                      d+ina+GygltlGvh+ri+et++++ +++++Gnvyvnrn+vGavvGvqpfGGeGlsGtGpk
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015 1034 DQINASGYGLTLGVHTRIDETIAKVIDNVHAGNVYVNRNIVGAVVGVQPFGGEGLSGTGPK 1094
                                                      ************************************************************* PP

                                       TIGR01238  486 aGGplylyrltrvr 499 
                                                      aGGplylyrl+++r
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_09015 1095 AGGPLYLYRLLSTR 1108
                                                      **********9876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (500 nodes)
Target sequences:                          1  (1317 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 22.68
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory