Align Purine/cytidine ABC transporter permease protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate AO356_07985 AO356_07985 ABC transporter permease
Query= TCDB::A2RKA5 (317 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_07985 Length = 308 Score = 150 bits (379), Expect = 4e-41 Identities = 99/304 (32%), Positives = 158/304 (51%), Gaps = 19/304 (6%) Query: 4 VNTLQIIVANMLIYSTPLIFTSIGGVFSERGGIVNVGLEGIMTIGAFSSVVFNLTTAGMF 63 ++ L I M+ TPL+ ++G + E+ G++N+G EG+M GA + F Sbjct: 3 IDLLSNIFYAMVRCGTPLLLVALGELVCEKSGVLNLGQEGMMLFGAVIGFIV------AF 56 Query: 64 GSMTPWLSILFGALIGALFSSLHAVATVNLRADHIVSGTVLNLMAPALGVFLLQVFYQQG 123 S WL +L G L S+L A+ + A+ + +G L + L F+ G Sbjct: 57 NSGNLWLGVLLAMAAGMLLSALFALVALVFNANQVATGLALTIFGVGLSSFV-------G 109 Query: 124 QININEQIGYWN---VPLLSNIPVIGKIFFTQTSLPGFLAIVVAILAWYVLFKTRFGLRL 180 + + + + +P LS+IP+IG++ F Q L + A++AW VL K+R GL + Sbjct: 110 AAWVGKPLAGFEPLAIPYLSDIPLIGRMLFAQDLLVYLSFALFALVAW-VLMKSRTGLII 168 Query: 181 RSVGENPQAADTLGINVYAYRWAGVLLSGVLGGVGGAIYAQAISGNFSVSTIAGQGFISL 240 ++VGENP AA +G+ V R VL G + G+ GA + A + ++ + AG+G+I+L Sbjct: 169 QAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMSAGRGWIAL 228 Query: 241 AAMIFGKWNPIGAMLSSLLFGLFTSLAVVGGQIPGIKEIPSSFLQMAPYVFTIIVLALFL 300 A ++F W +L + LFGL + L +V Q G+ IPSS L M PY TI+VL L Sbjct: 229 ALVVFASWRVWRLLLGAYLFGLASILHLV-AQGLGL-AIPSSLLAMLPYAATIVVLVLLS 286 Query: 301 GKAI 304 A+ Sbjct: 287 RDAV 290 Lambda K H 0.326 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 308 Length adjustment: 27 Effective length of query: 290 Effective length of database: 281 Effective search space: 81490 Effective search space used: 81490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory