Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate AO356_27985 AO356_27985 sorbitol dehydrogenase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27985 Length = 257 Score = 135 bits (339), Expect = 1e-36 Identities = 91/253 (35%), Positives = 136/253 (53%), Gaps = 12/253 (4%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQL----HAGVADVS 67 G L++GAA GIG A AQA+++ GA V I D+D ++RA +L +A DV+ Sbjct: 6 GKSALVTGAARGIGRAFAQAYIEEGATVAIADID---LERANATAAELGDSAYAVKMDVT 62 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRK 127 D A +D+ I ++ G LD+LINNA + + D+ +ER N+ + L+ Sbjct: 63 DQASIDQAIAAVVAQAGKLDILINNAALFD-LAPIVDITRQSYERLFSINVAGTLFTLQA 121 Query: 128 AVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAI 187 A + II MAS AGR G A Y A+K A++ + +S ++L + + VNAI Sbjct: 122 AARQMIRQGHGGRIINMASQAGRRGEALVAVYCATKAAVISLTQSAGLDLIKHRINVNAI 181 Query: 188 LPGVVEGERMDRV--ISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPA 245 PGVV+GE D V + AR E+L G + K + Q++ RM T D+ MA+FLAS Sbjct: 182 APGVVDGEHWDGVDALFARHENLPQG--EKKRQVGQQVPYGRMGTAQDLTGMAIFLASAE 239 Query: 246 GQNISGQAISVDG 258 + + Q +VDG Sbjct: 240 SEYVVAQTYNVDG 252 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory