Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate AO356_15620 AO356_15620 (2Fe-2S)-binding protein
Query= metacyc::MONOMER-20832 (151 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_15620 Length = 173 Score = 106 bits (265), Expect = 2e-28 Identities = 56/154 (36%), Positives = 86/154 (55%), Gaps = 4/154 (2%) Query: 1 MELRINQKAYQVDADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRSCVTP 60 + L +N + ++ A T LL ++R+ L L G+K GC QCGAC+VL DG + +C+T Sbjct: 18 IRLTLNGQVRELQVLAWTTLLDLLREQLDLVGSKKGCDHGQCGACTVLRDGKRINACLTL 77 Query: 61 VAGVVGREITTIEAIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSKA 120 G E+ T+E + +D+ + +++H QCGYC GQ+ +A L A ++ Sbjct: 78 AVMCDGAELITVEGLASDDQLHPMQQAFIKHDAFQCGYCTPGQICSAVGLANEGRAKTRG 137 Query: 121 QIDAAMI-NLCRCGTYNAIHAAVDD---LAKQGG 150 QI M NLCRCG Y I A+++ L +QGG Sbjct: 138 QISELMSGNLCRCGAYTNIRDAIEEALPLCQQGG 171 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 97 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 151 Length of database: 173 Length adjustment: 17 Effective length of query: 134 Effective length of database: 156 Effective search space: 20904 Effective search space used: 20904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory