GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS05250 in Pseudomonas fluorescens FW300-N2C3

Align Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale)
to candidate AO356_28510 AO356_28510 xylose transporter

Query= uniprot:D8J111
         (520 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_28510 AO356_28510 xylose
           transporter
          Length = 518

 Score =  360 bits (924), Expect = e-104
 Identities = 210/501 (41%), Positives = 312/501 (62%), Gaps = 13/501 (2%)

Query: 22  VIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAGKSTLMKILSGVYQRDS--GDI 79
           ++ +  + K F GV AL+    ++  GE   L GENGAGKSTLMK+LS VY   +  G+I
Sbjct: 5   LLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPHGTWEGEI 64

Query: 80  LLDGKPVEITEPRQAQALGIGIIHQELNLMNHLSAAQNIFIGREPRKAMGLFIDEDELNR 139
           + DG+P++     + +A GI IIHQEL L+  LS A+NIF+G E     G  ++   +  
Sbjct: 65  IWDGQPLKAQSISETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLPGGR-MNYPAMIH 123

Query: 140 QAAAIFARMRL-DMDPSTPVGELTVARQQMVEIAKALSFDSRVLIMDEPTAALNNAEIAE 198
           +A A+   +++ DM+ S PV +     QQ+VEIAKAL+  +R+LI+DEP++AL  +EI  
Sbjct: 124 RAEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRSEIEV 183

Query: 199 LFRIIRDLQAQGVGIVYISHKMDELRQIADRVSVMRDGKYIATVPMQETSMDTIISMMVG 258
           L  IIRDL+A+GV  VYISHK+DE+  + D +SV+RDGK+IAT  M +  +  II+ MVG
Sbjct: 184 LLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGKHIATTAMTDMDIPKIITQMVG 243

Query: 259 RALDGEQRIPPDTSRNDVVLEVRGLN-------RGRAIRDVSFTLRKGEILGFAGLMGAG 311
           R +       P     +V+ E R +        R + + D+SF L++GEILG AGL+GAG
Sbjct: 244 REMSNLYPTEPHDI-GEVIFEARHVTCYDVDNPRRKRVDDISFVLKRGEILGIAGLVGAG 302

Query: 312 RTEVARAIFGADPLE-AGEIIIHGGKAVIKSPADAVAHGIGYLSEDRKHFGLAVGMDVQA 370
           RTE+  A+FGA P    GE+ ++G +   ++P  ++  G+  + EDRK  G+   + V  
Sbjct: 303 RTELVSALFGAYPGRYEGEVWLNGQQIDTRTPLKSIRAGLCMVPEDRKRQGIIPDLGVGQ 362

Query: 371 NIALSSMGRFTRVGFMDQRAIREAAQMYVRQLAIKTPSVEQQARLLSGGNQQKIVIAKWL 430
           NI L+ +  ++++  +D  A   +    + ++ +KT S       LSGGNQQK V+AK L
Sbjct: 363 NITLAVLDNYSKLTRIDAEAELGSIDKEIARMHLKTASPFLPITSLSGGNQQKAVLAKML 422

Query: 431 LRDCDILFFDEPTRGIDVGAKSEIYKLLDALAEQGKAIVMISSELPEVLRMSHRVLVMCE 490
           L    +L  DEPTRG+DVGAK EIYKL+ ALA +G +I+M+SSEL EVL +S RVLV+ +
Sbjct: 423 LTKPRVLILDEPTRGVDVGAKYEIYKLMGALAAEGVSIIMVSSELAEVLGVSDRVLVIGD 482

Query: 491 GRITGELARADATQEKIMQLA 511
           G++ G+    + TQE+++  A
Sbjct: 483 GQLRGDFINHELTQEQVLAAA 503



 Score = 71.6 bits (174), Expect = 6e-17
 Identities = 69/253 (27%), Positives = 116/253 (45%), Gaps = 20/253 (7%)

Query: 274 NDVVLEVRGLNRG----RAIRDVSFTLRKGEILGFAGLMGAGRTEVARAIFGADPLEA-- 327
           +D +L++ G+ +     +A+  +   +R GE +G  G  GAG++ + + +    P     
Sbjct: 2   SDYLLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPHGTWE 61

Query: 328 GEIIIHGGKAVIKSPADAVAHGIGYLSEDRKHFGLAVGMDVQANIALSSMGRFTRV--GF 385
           GEII  G     +S ++  A GI  + ++     L   + V  NI    MG    +  G 
Sbjct: 62  GEIIWDGQPLKAQSISETEAAGIVIIHQE---LTLVPDLSVAENIF---MGHELTLPGGR 115

Query: 386 MDQRAIREAAQMYVRQLAIKTPSVEQQARLLSGGNQQKIVIAKWLLRDCDILFFDEPTRG 445
           M+  A+   A+  +R+L +   +V        GG QQ + IAK L +   +L  DEP+  
Sbjct: 116 MNYPAMIHRAEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSA 175

Query: 446 IDVGAKSEIYKLLDALAE---QGKAIVMISSELPEVLRMSHRVLVMCEGRITGELARADA 502
           +    +SEI  LLD + +   +G A V IS +L EV  +   + V+ +G+     A  D 
Sbjct: 176 L---TRSEIEVLLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGKHIATTAMTDM 232

Query: 503 TQEKIMQLATQRE 515
              KI+     RE
Sbjct: 233 DIPKIITQMVGRE 245


Lambda     K      H
   0.320    0.135    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 644
Number of extensions: 37
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 520
Length of database: 518
Length adjustment: 35
Effective length of query: 485
Effective length of database: 483
Effective search space:   234255
Effective search space used:   234255
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory