Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate AO356_28740 AO356_28740 oxidoreductase
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28740 Length = 246 Score = 308 bits (790), Expect = 5e-89 Identities = 163/243 (67%), Positives = 183/243 (75%), Gaps = 1/243 (0%) Query: 5 LAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDGLAG-KPVEARKLDVRDDAAIK 63 L K L+TAAGQGIGLA+A FAR GA VIATDI I LAG + V A LDV AAI Sbjct: 3 LQNKRVLVTAAGQGIGLASAIAFARAGAEVIATDIDIHALAGIEEVTAMSLDVTSTAAIS 62 Query: 64 ALAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFLPAMLDKGGG 123 A IG +DVLFNCAG+VH+GNIL+C E W + DLNV AMYRMI AFLP ML +GGG Sbjct: 63 AACERIGGLDVLFNCAGYVHSGNILQCDEAAWARSMDLNVTAMYRMIHAFLPGMLARGGG 122 Query: 124 SIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICPGTVASPSLE 183 SIINMSS ASSVKGVPNRFAY+ SKAAV+GLTK+VA DF+++G+RCNAICPGTV SPSL Sbjct: 123 SIINMSSVASSVKGVPNRFAYATSKAAVVGLTKAVAIDFVSQGIRCNAICPGTVDSPSLR 182 Query: 184 QRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFTTGHAHVIDG 243 QRI QA QG V F+ RQPMGRIG EEIA LA+YLGSD S++TTG HVIDG Sbjct: 183 QRIADQAVQQGVDEAQVYRQFLDRQPMGRIGSTEEIAQLAVYLGSDASAYTTGAIHVIDG 242 Query: 244 GWS 246 G S Sbjct: 243 GMS 245 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 246 Length adjustment: 24 Effective length of query: 223 Effective length of database: 222 Effective search space: 49506 Effective search space used: 49506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory