Align L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 (characterized)
to candidate AO356_05220 AO356_05220 phosphogluconate dehydratase
Query= SwissProt::B5ZZ34 (579 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_05220 Length = 608 Score = 196 bits (498), Expect = 2e-54 Identities = 157/517 (30%), Positives = 251/517 (48%), Gaps = 51/517 (9%) Query: 47 IGILNTWSDMTPCNGHLRELAEKVKAGVWE-------AGGFPLEVPVFSASENTFRPTAM 99 I I+++++DM + E++K + E AGG P + E ++ Sbjct: 68 IAIVSSYNDMLSAHQPYETFPEQIKKALREIGSVGQFAGGTPAMCDGVTQGEAGME-LSL 126 Query: 100 MYRNLAALAVEEAIRGQPMDGCVLLVGCDKTTPSLLMGAASCD-LPSIVVTGGPMLNGYF 158 R + AL+ A+ DG ++L CDK P L+MGA LP+I V GGPM++G Sbjct: 127 PSREVIALSTAVALSHNMFDGALMLGICDKIVPGLMMGALRFGHLPTIFVPGGPMVSGIS 186 Query: 159 RGERVGSGTHLWKFSEMVKAGEMTQAEFLEAEASMSRSSGTCNTMGTASTMASMAEALGM 218 E+ + G+ T+ E LE+E S GTC GTA+T + E +G+ Sbjct: 187 NKEKAD-------VRQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGL 239 Query: 219 ALSGNAAIPGVDSRRKVMAQLTGRRIVQMVKDD---LKPSEIMTKQAFENAIRTNAAIGG 275 L G + + R + + ++ +M K + EI+ +++ N+I A GG Sbjct: 240 HLPGASFVNPNTPLRDALTREAAFQVTRMTKQSGNFMPIGEIVDERSLVNSIVALHATGG 299 Query: 276 STNAVIHLLAIAGRVGIDLSLDDWDRCGRDVPTIVNLMPSGKYLMEEFFYAGGLPVVLKR 335 STN +H+ AIA GI L+ D VPT+ ++ P+GK + F AGG+ +++ Sbjct: 300 STNHTLHMPAIAMAAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGMSFLIRE 359 Query: 336 LGEAGLLHKDALTV---------------SGETVWDEVKDVVNWNEDVILPAEKALTSSG 380 L EAGLLH++ TV GE VW + + + +E+++ P +A + G Sbjct: 360 LLEAGLLHENVNTVLGHGLSRYTQEPFLEDGELVWRD-GPIESLDENILRPVARAFSPEG 418 Query: 381 GIVVLRGNLAPKGAVLKPSAASPHLLVHKGRAVVFED----IDDYKAKINDDNLDIDENC 436 G+ V+ GNL V+K SA + + + A+VF+D D +KA + ++++ Sbjct: 419 GLRVMEGNLG--RGVMKVSAVALENQIVEAPAMVFQDQQDLADAFKAGL------LEKDF 470 Query: 437 IMVMKNCGPKGYPGMAEVGNMGLPPKVLKKGILDMVRISDARMSGTAYGTV--VLHTSPE 494 + VM+ GP+ GM E+ M VL+ + ++D RMSG A G + +H SPE Sbjct: 471 VAVMRFQGPRS-NGMPELHKMTPFLGVLQDRGFKVALVTDGRMSG-ASGKIPAAIHVSPE 528 Query: 495 AAVGGPLAVVKNGDMIELDVPNRRLHLDISDEELARR 531 A VGG LA V+ GD+I +D L L + EE A R Sbjct: 529 AYVGGALARVQEGDIIRVDGVKGTLELKVDAEEFAAR 565 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 781 Number of extensions: 43 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 608 Length adjustment: 37 Effective length of query: 542 Effective length of database: 571 Effective search space: 309482 Effective search space used: 309482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory