Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate AO356_03355 AO356_03355 hypothetical protein
Query= curated2:Q56623 (328 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_03355 Length = 318 Score = 214 bits (544), Expect = 3e-60 Identities = 118/316 (37%), Positives = 186/316 (58%), Gaps = 4/316 (1%) Query: 13 LLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHAVNKDDGLLFEVGDINASTDFELPLKNTT 72 L+TG++G++G+ L K L + Y VK R ++ + D+ + + Sbjct: 3 LVTGASGYIGSLLCKVLKARG-YAVKGIGRSSMTPSQDFDYVCLDLE-NDPLDGVCLGVE 60 Query: 73 VVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIKVNGEGTL 132 +VH A RAH+++DKE +PL+ +R N T+ LA++A+ GVKRF+FISSI V+ T Sbjct: 61 TIVHLAGRAHILNDKEEDPLSAFRRANVNATLRLAEEAMRGGVKRFVFISSIGVSATETK 120 Query: 133 VGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGVKANFASLM 192 + N+ P Y LSK EAE+ L AL KDSSME+VIIRP +VYG NF L+ Sbjct: 121 NSKVSELSGNN-PSTPYALSKFEAEEALKALVKDSSMELVIIRPPLVYGGSAPGNFHRLL 179 Query: 193 RLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHDVSTAEMVR 252 ++V G+PLPF + N+RS+++++NL+D IV CI HP AA ++FL+SDG DVST ++VR Sbjct: 180 KIVRLGMPLPFLA-ANNQRSMIALDNLIDFIVHCIKHPAAAGELFLISDGTDVSTVDIVR 238 Query: 253 ELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGWKPPQTLQ 312 +A + + + VP+ ++ KL G+ ++ +L G+L +D + LGW PP Sbjct: 239 TIANGMGRKPRLIYVPVGVIRVAAKLLGRENMFSQLFGSLVIDSGKAHQLLGWTPPLGTT 298 Query: 313 EGFKQTAQAFLQANNR 328 E + ++ +++ Sbjct: 299 EALSKAGADYMTLSSK 314 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 318 Length adjustment: 28 Effective length of query: 300 Effective length of database: 290 Effective search space: 87000 Effective search space used: 87000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory