Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate AO356_26155 AO356_26155 rhamnonate dehydratase
Query= BRENDA::A9CEQ8 (378 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_26155 Length = 394 Score = 147 bits (372), Expect = 4e-40 Identities = 112/372 (30%), Positives = 176/372 (47%), Gaps = 30/372 (8%) Query: 9 HLLEHRLDTPFES-ASMRFDRRAH-------VLVEIECDDGTVGWGECLGPARPNAAVVQ 60 H ++ + TP R RR+ ++VEIE +DGTVG+ G P A +V+ Sbjct: 28 HWIDDHIATPMSKYPDYRQSRRSFGINVLGTLVVEIEANDGTVGFAVTTG-GEPAAYIVE 86 Query: 61 AYSGWLI-GQDPRQTEKIWAVLYNALRDQGQRGLSLTALSGIDIALWDIKGKHYGASISM 119 + + G EKIW +Y + G++GL + +SG+D+ALWD+ GK + Sbjct: 87 KHLARFVEGARVTDIEKIWDQMYQSTLYYGRKGLVINTISGVDLALWDLLGKIRQEPVHQ 146 Query: 120 LLGGRWRESVRAYATGSFKRDNVDRVSDNASEMAERR--AEGFHACKIKIGFGVEEDLRV 177 LLGG R+ ++ YATG+ + D ++ +M AEG G+ ++L Sbjct: 147 LLGGAVRDELQFYATGA-RPDLAQKMGFIGGKMPLHHGPAEGEE--------GLRKNLEA 197 Query: 178 IAAVREAIGPDMRLMIDANHGYTVTEAITLGDRAAGFGIDWFEEPVVPEQLDAYARVRAG 237 +A +RE +GPD LM+D + A L A G+ W EE + P+ YA +R Sbjct: 198 LATMRERVGPDFWLMLDCWMSLDLNYATKLAVGAHEHGLKWIEEALPPDDYWGYAALRKN 257 Query: 238 QP--IPVAGGETWHGRYGMWQALSAGAVDILQPDLCGCGGFSEIQKIATLATLHGVRIVP 295 P + V GE R+G L G DI+QPD+ CGG +E+ KI+ LA H ++P Sbjct: 258 VPKGMLVTTGEHEATRWGFRMLLEMGCCDIIQPDVGWCGGLTELVKISALADAHNALVIP 317 Query: 296 HVWGTGVQIAAALQFMAAMTPDPVRVNPIEPIMEFDRTHNPFRQAVLREPLEAVNGV-VT 354 H G+ V + F+A P + + D F +L EP+ + ++ Sbjct: 318 H--GSSVY---SYHFVATRHNSPF-AEFLMMAPKADEVVPMFHPQLLGEPVPVQGRMRLS 371 Query: 355 IPDGPGLGIEIN 366 + D PG G+ +N Sbjct: 372 VLDQPGFGVTLN 383 Lambda K H 0.321 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 394 Length adjustment: 30 Effective length of query: 348 Effective length of database: 364 Effective search space: 126672 Effective search space used: 126672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory