Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate AO356_10420 AO356_10420 polar amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_10420 Length = 221 Score = 136 bits (343), Expect = 3e-37 Identities = 77/216 (35%), Positives = 127/216 (58%), Gaps = 2/216 (0%) Query: 1 MNYQLNFAAVWRDFDTLLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVY 60 MN+ ++A + L +G+ L++ L++IA ++ L+ A L+ + L+ L +Y Sbjct: 1 MNF--DYAFILSTLPAFLKAVGVTLQVGLIAIATSLLVALVNATILVLRTPYLQRLVGLY 58 Query: 61 VTVIRNTPILVLILLIYFALPSLGIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGL 120 V + RNTP+L+ + +YFALP+LGI++ + IIT++ GAYLTEV R G+ ++P+ Sbjct: 59 VELARNTPLLIQLFFVYFALPALGIKVSGFAAAIITMTFLGGAYLTEVLRAGVDAVPQAQ 118 Query: 121 REAGLAIGLGEWQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKI 180 E+G +IGL Q+ YV +P LP+L NFI L K+T++ +A+AVPE+ Y + Sbjct: 119 LESGRSIGLSHGQLLRYVILPQAGILSLPSLFANFIFLLKETTVVSAVAVPEILYTTKSY 178 Query: 181 NVESYRVIETWLVTTALYVAACYLIAMLLRYLEQRL 216 Y+ E V T + V +++LL LE+RL Sbjct: 179 IALYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRL 214 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 221 Length adjustment: 22 Effective length of query: 198 Effective length of database: 199 Effective search space: 39402 Effective search space used: 39402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory