Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate AO356_28630 AO356_28630 polar amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28630 Length = 258 Score = 124 bits (310), Expect = 2e-33 Identities = 77/210 (36%), Positives = 116/210 (55%), Gaps = 14/210 (6%) Query: 20 SGFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPVFVLVLACFY 79 +G + SVLA++LG +G+ A L+ + P RFYV L+RGTP+ V ++ Y Sbjct: 21 TGLWLTCLISVLAMLLGCALGLAAALLRLSSNPLLHLPVRFYVWLMRGTPLLVQIVF-LY 79 Query: 80 MAPALGW-----QIDAF--------QAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASK 126 A A G ID F QA ++ L L G+++AEI+R + A+ +GQ EA + Sbjct: 80 TALAAGGIFRFEDIDLFGLVIPGNIQAAIIALGLNEGAYMAEIIRAGIGAVDKGQYEAGR 139 Query: 127 AIGLTFYQALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTF 186 ++G+TF + + ++LPQA R I+P N ++K +TL+SVIGV ELLLSTQ + + TF Sbjct: 140 SLGMTFAKLMRRIVLPQAFRVIVPPLGNEFNVMLKNTTLVSVIGVQELLLSTQMVTSATF 199 Query: 187 MTLEFYLFAGFLFFIINYAIELLGRHIEKR 216 E YL F ++ R +E R Sbjct: 200 RVFELYLVVAIYFLLLTTLWGFFQRWLETR 229 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 258 Length adjustment: 23 Effective length of query: 197 Effective length of database: 235 Effective search space: 46295 Effective search space used: 46295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory