Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate AO356_28580 AO356_28580 sugar ABC transporter permease
Query= reanno::Smeli:SMc02871 (279 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28580 Length = 280 Score = 142 bits (359), Expect = 6e-39 Identities = 94/270 (34%), Positives = 145/270 (53%), Gaps = 16/270 (5%) Query: 18 LIAYTLI-ALFPVFLTIVNSFKSRNAIFREPLAVPTPETFSLIGYETVLKQGDFIGYFQN 76 LIA L+ A+FP + IV S K +A+F+ + P+ FS Y VL Q F+ N Sbjct: 18 LIAILLVYAVFPFYYAIVTSLKPSSALFQVSYWIDQPD-FS--NYAAVLNQASFLRAIGN 74 Query: 77 SIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGI-MIPIRLGTVAILQGMV- 134 S++V + +AL L AA+AL +FRG + L + LG+ M P VA+L G+ Sbjct: 75 SLVVALCVVALALFLSLTAAYALGRVKFRGRGPV-LMMVLGVSMFP----QVAVLSGLFE 129 Query: 135 ---ATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDGLSEYAIFLRLV 191 A GL NT ALIL YT LP V++L+ FM + +L+ A +DG S + R++ Sbjct: 130 VIRALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVL 189 Query: 192 LPLIRPAMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLGSQIFIG--QFVTNWNAVLS 249 LPL+ PA+ T + I WN+ F L ++ +TV + + G W +++ Sbjct: 190 LPLLWPALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPHELPWGLLMA 249 Query: 250 ALSLAIFPVLVLYVIFSRQLIRGITAGAVK 279 A L P+++L +IF R+++ G+TAGA+K Sbjct: 250 ASVLVTVPLVILVLIFQRRIVSGLTAGALK 279 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 280 Length adjustment: 26 Effective length of query: 253 Effective length of database: 254 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory