GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagEcba in Pseudomonas fluorescens FW300-N2C3

Align protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized)
to candidate AO356_17535 AO356_17535 PTS N-acetyl-D-glucosamine transporter

Query= BRENDA::P09323
         (648 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_17535 AO356_17535 PTS
           N-acetyl-D-glucosamine transporter
          Length = 571

 Score =  479 bits (1232), Expect = e-139
 Identities = 251/491 (51%), Positives = 331/491 (67%), Gaps = 18/491 (3%)

Query: 8   QRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAGGAIFDNLALIFAIGVASSWSKD 67
           QRLGRAL LPIA+LP+A LLLR G  DLL++A I  AG AIF NLA+IFAIG+A  +++D
Sbjct: 10  QRLGRALMLPIAILPIAGLLLRLGDTDLLDIAIIHDAGQAIFANLAMIFAIGIAVGFARD 69

Query: 68  SAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIITGLVGGAAYNRWSDIKLPDFLSFF 127
           + G A LAGA+GY V+   +  ++  INMG+LAGII+GL+ GA YNR+ DIKLP++L+FF
Sbjct: 70  NNGTAGLAGAIGYLVMIATLKVLDASINMGMLAGIISGLLAGALYNRFKDIKLPEYLAFF 129

Query: 128 GGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPT 187
           GG+RFVPI TGF  + L  +FG +WPP+Q  I+  G  ++ +G+ G+ +FG  NRLLI T
Sbjct: 130 GGRRFVPIVTGFSAVGLGVVFGLIWPPIQQGINGFGALLMESGSFGAFVFGVFNRLLIVT 189

Query: 188 GLHQVLNTIAWFQIGEFTN-AAGTVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLPGAAL 246
           GLH +LN +AWF  G FT+ A G V  GD++R++AGD   G FM+G FP+M+FGLP A L
Sbjct: 190 GLHHILNNMAWFIFGSFTDPATGAVVTGDLSRYFAGDPKGGQFMTGMFPVMLFGLPAACL 249

Query: 247 AMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLAPLLYLLHALLTGISLFVA 306
           AMY  A  +RR ++GG+LLS+A+T+FLTGVTEP+EF FMFLAPLL+L+HALLTG+S+ V 
Sbjct: 250 AMYRNALPQRRKVMGGILLSMALTSFLTGVTEPIEFAFMFLAPLLFLVHALLTGVSMAVT 309

Query: 307 TLLGIHAGFSFSAGAIDYALMYNLPAASQNVWMLLVMGVIFFAIYFVVFSLVIRMFNLKT 366
            LLGIH GF+FS G ID  L +     S N W+++ +G+ + AIY++VF   IR F+LKT
Sbjct: 310 NLLGIHLGFTFSGGFIDMVLGW---GKSTNGWLVVPVGLAYAAIYYLVFDFCIRRFDLKT 366

Query: 367 PGREDKEDEIVTEEANSNTEEGLTQLATNYIAAVGGTDNLKAIDACITRLRLTVADSARV 426
           PGRE+         A         Q A  YI A+GG DNL  I AC TRLRL + D  + 
Sbjct: 367 PGREE-------VPAGDKPAIAENQRAAAYIQALGGADNLITIGACTTRLRLDMVDRNKA 419

Query: 427 NDTMCKRLGASGVVKL-NKQTIQVIVGAKAESIGDAMKKVV------ARGPVAAASAEAT 479
           +D   K LGA  VV+  N  ++QV+VG  A+SI D ++  V         PV  A A  T
Sbjct: 420 SDAQLKALGAMAVVRPGNGGSLQVVVGPMADSIADEIRLAVPSSLRPVTAPVPNAPAPTT 479

Query: 480 PATAAPVAKPQ 490
           PA  +     Q
Sbjct: 480 PAALSSTEAQQ 490



 Score = 39.7 bits (91), Expect = 4e-07
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 7/86 (8%)

Query: 378 TEEANSNTEEGLTQLATNYIAAVGGTDNLKAIDACIT-RLRLTVADSARVNDTMCKRLGA 436
           T  A S+TE      A  ++ A+GG DN+  ++   T RLR+ +AD   ++++  K LG 
Sbjct: 479 TPAALSSTE------AQQWLDALGGQDNVLQLECVATSRLRVRLADDKGLSESRLKGLGC 532

Query: 437 SGVVKLNKQTIQVIVGAKAESIGDAM 462
            G+  L      +++G KA  +  A+
Sbjct: 533 QGMSSLEDGVWHLLLGEKAPRLWQAL 558


Lambda     K      H
   0.324    0.139    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 932
Number of extensions: 49
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 648
Length of database: 571
Length adjustment: 37
Effective length of query: 611
Effective length of database: 534
Effective search space:   326274
Effective search space used:   326274
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory