GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Pseudomonas fluorescens FW300-N2C3

Align N-Acetyl-D-Glucosamine phosphotransferase system transporter, component of N-acetyl glucosamine-specific PTS permease, GlcNAc IIBC/GlcNAc I-HPr-IIA (characterized)
to candidate AO356_10350 AO356_10350 phosphoenolpyruvate-protein phosphotransferase

Query= TCDB::Q9HXN5
         (842 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10350 AO356_10350
           phosphoenolpyruvate-protein phosphotransferase
          Length = 759

 Score =  272 bits (696), Expect = 5e-77
 Identities = 199/628 (31%), Positives = 314/628 (50%), Gaps = 26/628 (4%)

Query: 222 IMGLGVAEQDEVEVICRGEDSEAALGALLAALASATAGAPKDAPRAIAPGEPARPAAVAG 281
           ++G+ V +Q E      GE  EA L  + A LA   A A  +A  +I+            
Sbjct: 121 VVGVLVIQQKERRQFDEGE--EAFLVTMSAQLAGVIAHA--EATGSISGLGRQGKGIQEA 176

Query: 282 TLAGVCASPGLASGPLARLGAISLPADDGRHRPEEQHLALDQ-------ALQRVRDDVQG 334
              GV  SPG A G       + LP  D    P++    ++        A++ VR D++ 
Sbjct: 177 KFVGVPGSPGAAVGT----AVVMLPPADLDVVPDKTITDINAELGLFKTAIEGVRADMRA 232

Query: 335 SLQQARLGGDENEAAIFSAHLALLEDPGLLDAADMLIDQGVGAAHAWHRAIQAQCEILQA 394
              +        E A+F  +L +L+D  L      +I  G  A  A  + +       + 
Sbjct: 233 LSAKLATQLRPEERALFDVYLMMLDDASLGSEVTTVIKTGQWAQGALRQVVTDHVNRFEL 292

Query: 395 LGNLLLAERANDLRDLEKRVLRVLLGDTAPLRV-PAGAIVAAREITPSDLAPLVDAGAAG 453
           + +  L ERA+D++DL +R+L  L  +     V P   I+ + E+TP+ L  + +   AG
Sbjct: 293 MDDAYLRERASDVKDLGRRLLAYLQQERQQTLVYPDNTILVSEELTPAMLGEVPEGKLAG 352

Query: 454 LCMAEGGATSHVAILARSKGLPCLVALGAGLLELEEGRQVVLDAGQGRLELSPDARRLEQ 513
           L    G   SHVAILAR+ G+P ++ L        +G Q+++D   G +  +P     +Q
Sbjct: 353 LVSVLGSGNSHVAILARAMGIPTVMGLVDLPYSKVDGIQMIVDGYHGEVYTNPSDVLRKQ 412

Query: 514 VALQVAQREEQRRRQQADAQRE--ALTRDGRRIEIGANVASPREAAEAFANGADGVGLLR 571
            A  V   EE++     DA R+   +T DG R+ +  N     + A A   GA+GVGL R
Sbjct: 413 FADVV--EEEKQLSLGLDALRDLPCVTLDGHRMPLWVNTGLLADVARAQKRGAEGVGLYR 470

Query: 572 TEFLFLERRAAPDEEEQRNAYQEVLDAMGQRKVIIRTIDVGGDKHLDYLPLPVEENPALG 631
           TE  F+  +  P E+EQ   Y+E L A   + V +R++D+GGDK L Y P+  E+NP LG
Sbjct: 471 TEVPFMINQRFPSEKEQLAIYREQLAAFHPQPVTMRSLDIGGDKSLSYFPIK-EDNPFLG 529

Query: 632 LRGIHLGQARPELLDQQLRALLRV-EPLERCRILLPMVSEVDELRA----IRRRLGELAT 686
            RGI +    PE+   Q RA+L+  E L   RILLPM+S   EL      I R  GE+  
Sbjct: 530 WRGIRVTLDHPEIFLVQARAMLKASEGLNNLRILLPMISGTHELEEALHLIHRAWGEVRD 589

Query: 687 QLGIERLPELGVMIEVPSAALLADQLAEHADFLSIGTNDLSQYALAMDRCHAGLADRIDA 746
           +     +P +GVMIE+P+A     +LA   DFLS+G+NDL+QY LA+DR +  +AD  D 
Sbjct: 590 EGTDVPMPPVGVMIEIPAAVYQTKELARQVDFLSVGSNDLTQYLLAVDRNNPRVADLYDY 649

Query: 747 LHPALLRLIAQTCAGAARHGRWVGVCGALASDPLATPVLVGLGVEELSVGPNLVGEIKTR 806
           LHPA+L+ +      A   G+ V +CG +A DP A  +L+ +G + LS+    + ++K  
Sbjct: 650 LHPAVLQALQNVVRDAHAEGKPVSICGEMAGDPAAAVLLMAMGFDSLSMNATNLPKVKWM 709

Query: 807 VRQLDAAECRRHAQALLDLGSARAVRDA 834
           +RQ++ ++ +     ++ + + + +  +
Sbjct: 710 LRQINLSKAQELLAEVMTIDNPQVIHSS 737


Lambda     K      H
   0.319    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1282
Number of extensions: 65
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 842
Length of database: 759
Length adjustment: 41
Effective length of query: 801
Effective length of database: 718
Effective search space:   575118
Effective search space used:   575118
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory