GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ptsG in Pseudomonas fluorescens FW300-N2C3

Align protein-Npi-phosphohistidine-D-glucose phosphotransferase (EC 2.7.1.199) (characterized)
to candidate AO356_17535 AO356_17535 PTS N-acetyl-D-glucosamine transporter

Query= BRENDA::P69786
         (477 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_17535 AO356_17535 PTS
           N-acetyl-D-glucosamine transporter
          Length = 571

 Score =  369 bits (947), Expect = e-106
 Identities = 200/476 (42%), Positives = 296/476 (62%), Gaps = 26/476 (5%)

Query: 1   MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMP 60
           M+++    LQ++G++LMLP+++LPIAG+LL +G  +   L   + H   +AG ++FAN+ 
Sbjct: 1   MYQHFIEGLQRLGRALMLPIAILPIAGLLLRLGDTDL--LDIAIIH---DAGQAIFANLA 55

Query: 61  LIFAIGVALGFT-NNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVL 119
           +IFAIG+A+GF  +N+G + LA  + Y +M+ T+ V+   +              + G+L
Sbjct: 56  MIFAIGIAVGFARDNNGTAGLAGAIGYLVMIATLKVLDASI--------------NMGML 101

Query: 120 GGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAI 179
            GIISG +A  ++NRF  IKLPEYL FF G+RFVPI++G +A+  GVV   IWPPI   I
Sbjct: 102 AGIISGLLAGALYNRFKDIKLPEYLAFFGGRRFVPIVTGFSAVGLGVVFGLIWPPIQQGI 161

Query: 180 QTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTN-AAGQVFHGDIP 238
             F           AF ++G   R L+  GLHHI N       G +T+ A G V  GD+ 
Sbjct: 162 NGFGALLMESGSFGAF-VFGVFNRLLIVTGLHHILNNMAWFIFGSFTDPATGAVVTGDLS 220

Query: 239 RYMAGDPTAGK-LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGIT 297
           RY AGDP  G+ ++G F   ++GLPAA +A++ +A P+ R  +GGI++S ALTSFLTG+T
Sbjct: 221 RYFAGDPKGGQFMTGMFPVMLFGLPAACLAMYRNALPQRRKVMGGILLSMALTSFLTGVT 280

Query: 298 EPIEFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLF 357
           EPIEF+FMF+AP+L+++HA+L G++  +  LLG+  G +FS G ID ++  G S+  WL 
Sbjct: 281 EPIEFAFMFLAPLLFLVHALLTGVSMAVTNLLGIHLGFTFSGGFIDMVLGWGKSTNGWLV 340

Query: 358 PIVGIGYAIVYYTIFRVLIKALDLKTPGREDA-TEDAKATGTSEMAPALVAAFGGKENIT 416
             VG+ YA +YY +F   I+  DLKTPGRE+    D  A   ++ A A + A GG +N+ 
Sbjct: 341 VPVGLAYAAIYYLVFDFCIRRFDLKTPGREEVPAGDKPAIAENQRAAAYIQALGGADNLI 400

Query: 417 NLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSG--VQAIFGTKSDNLKTEM 470
            + AC TRLR+ + D +K   A LK LGA  VV  G+G  +Q + G  +D++  E+
Sbjct: 401 TIGACTTRLRLDMVDRNKASDAQLKALGAMAVVRPGNGGSLQVVVGPMADSIADEI 456



 Score = 36.2 bits (82), Expect = 3e-06
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 398 TSEMAPALVAAFGGKENITNLDACIT-RLRVSVADVSKVDQAGLKKLGAAGVVVAGSGV- 455
           +S  A   + A GG++N+  L+   T RLRV +AD   + ++ LK LG  G+     GV 
Sbjct: 484 SSTEAQQWLDALGGQDNVLQLECVATSRLRVRLADDKGLSESRLKGLGCQGMSSLEDGVW 543

Query: 456 QAIFGTKSDNLKTEMD 471
             + G K+  L   +D
Sbjct: 544 HLLLGEKAPRLWQALD 559


Lambda     K      H
   0.325    0.140    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 810
Number of extensions: 55
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 477
Length of database: 571
Length adjustment: 35
Effective length of query: 442
Effective length of database: 536
Effective search space:   236912
Effective search space used:   236912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory