Align 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 (characterized)
to candidate AO356_25560 AO356_25560 2-keto-3-deoxy-L-rhamnonate aldolase
Query= SwissProt::P23522 (256 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_25560 Length = 265 Score = 224 bits (572), Expect = 1e-63 Identities = 115/249 (46%), Positives = 160/249 (64%), Gaps = 1/249 (0%) Query: 8 NKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKG 67 N FK L + + QIG W L++ E+ AGFDWL++DGEHAPND+ T + QL A+ Sbjct: 6 NTFKQRLRSGEAQIGLWLGLADAYCAELAANAGFDWLLIDGEHAPNDLRTLLGQLQAVAP 65 Query: 68 SASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGV-SVS 126 PV+R + +IK++LDIG L+P VE+ E+A V + YPP+G+RGV S Sbjct: 66 YPGQPVIRPVVGDTALIKQVLDIGVQTLLVPMVESAEQARELVRAIHYPPQGVRGVGSAL 125 Query: 127 HRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAALGH 186 RA+ + ++ Y ++++ + +LVQIES++G+ N+DAIAA EGVDG+F+GP+DL+A++G Sbjct: 126 ARASRWNSIPGYLDKADEQMCLLVQIESREGLANLDAIAAVEGVDGVFIGPADLSASMGF 185 Query: 187 LGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSA 246 GN HP VQ AI+ R GK +GIL+ E ARRY+E GA FVAVG D V Sbjct: 186 RGNPGHPQVQAAIEDAIARIRQAGKAAGILSADEKLARRYIELGAAFVAVGVDTTVLMRG 245 Query: 247 TQKLADTFK 255 Q LA TFK Sbjct: 246 LQTLAATFK 254 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 265 Length adjustment: 24 Effective length of query: 232 Effective length of database: 241 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory