Align tartronate semialdehyde reductase 2 (characterized)
to candidate AO356_19610 AO356_19610 2-hydroxy-3-oxopropionate reductase
Query= ecocyc::G6278-MONOMER (292 letters) >lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 AO356_19610 2-hydroxy-3-oxopropionate reductase Length = 296 Score = 373 bits (958), Expect = e-108 Identities = 189/291 (64%), Positives = 230/291 (79%), Gaps = 1/291 (0%) Query: 2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVAD-ELLSLGAVSVETARQVTEASDIIF 60 K+GFIG GIMG PMA+NL +AGH L ++ A +LL+ GAV++ ++V + ++ I Sbjct: 3 KIGFIGTGIMGHPMALNLQKAGHSLFLSQHHDAAPADLLAGGAVALANPKEVAQEAEFII 62 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVS 120 +MVPDTPQVE+VL +G GK ++DMSSISP TK FA ++NE G YLDAPVS Sbjct: 63 VMVPDTPQVEDVLLRADGIAAGVGAGKVVIDMSSISPTATKAFAAKINEKGAQYLDAPVS 122 Query: 121 GGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNI 180 GGE+GA+ TLSIMVGGD A FER PLF+ +GKNITLVGGNGDGQT KVANQIIVALNI Sbjct: 123 GGEVGAKAATLSIMVGGDSAAFERALPLFQAMGKNITLVGGNGDGQTAKVANQIIVALNI 182 Query: 181 EAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLN 240 +AV+EALLFA+K GADP +VR+ALMGGFASS+ILEVHGERMIK TF+PGF+I+LHQKDLN Sbjct: 183 QAVAEALLFAAKNGADPAKVREALMGGFASSKILEVHGERMIKGTFDPGFRISLHQKDLN 242 Query: 241 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKL 291 LALQ AK L +NLPNTA Q++F+TCAA GGS DHSAL++ LE MAN + Sbjct: 243 LALQGAKELNINLPNTANAQQVFSTCAAIGGSHWDHSALIKGLEHMANFSI 293 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 296 Length adjustment: 26 Effective length of query: 266 Effective length of database: 270 Effective search space: 71820 Effective search space used: 71820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate AO356_19610 AO356_19610 (2-hydroxy-3-oxopropionate reductase)
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.23288.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-123 397.3 9.9 2.2e-123 397.1 9.9 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 AO356_19610 2-hydroxy-3-oxopropi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 AO356_19610 2-hydroxy-3-oxopropionate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.1 9.9 2.2e-123 2.2e-123 1 289 [. 3 291 .. 3 293 .. 0.99 Alignments for each domain: == domain 1 score: 397.1 bits; conditional E-value: 2.2e-123 TIGR01505 1 kvgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmv 63 k+gfiG GimG+Pm+ nl kaG++l + ++ a ++lla Ga++ kev+++a+ i++mv lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 3 KIGFIGTGIMGHPMALNLQKAGHSLFLSQHHDAAPADLLAGGAVALANPKEVAQEAEFIIVMV 65 89************************************************************* PP TIGR01505 64 PdsPqveevalGenGileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeaga 126 Pd+Pqve+v+l +Gi + Gkv++dmssi+P ++k +a +++ekG ++ldaPvsGGe+ga lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 66 PDTPQVEDVLLRADGIAAGVGAGKVVIDMSSISPTATKAFAAKINEKGAQYLDAPVSGGEVGA 128 *************************************************************** PP TIGR01505 127 iegtlsimvGGdkavfdkvkpllealgksivlvGenGaGqtvkvanqvivalnieavsealvl 189 + +tlsimvGGd a f+++ pl++a+gk+i+lvG+nG+Gqt+kvanq+ivalni+av+eal++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 129 KAATLSIMVGGDSAAFERALPLFQAMGKNITLVGGNGDGQTAKVANQIIVALNIQAVAEALLF 191 *************************************************************** PP TIGR01505 190 aekaGvdpkavlqalrGGlagstvleakkerlldrdfkPGfridlhqkdlalaldaakavgaa 252 a k G+dp +v++al+GG+a+s++le+++er+++ +f+PGfri lhqkdl+lal+ ak++ ++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 192 AAKNGADPAKVREALMGGFASSKILEVHGERMIKGTFDPGFRISLHQKDLNLALQGAKELNIN 254 *************************************************************** PP TIGR01505 253 lPvtavvaellaalradGdgtldhsalvraleklakd 289 lP+ta ++++++++a G+++ dhsal++ le++a+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19610 255 LPNTANAQQVFSTCAAIGGSHWDHSALIKGLEHMANF 291 ***********************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (296 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.33 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory